CAZyme Information: MGYG000001378_03748

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_03748
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	MGYG000001378_8|CGC5	64840.88	6.5784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 233457; End: 235196 Strand: -

Full Sequence      

MKKKQVLLAVFAATMLTPTVVRAQYPQITGEAKENYTKMMTEERKRSDEAWAKALPIVQK
EAKEGRPYIPWAGRPYDLPQADIPSFPGAEGGGMYSFGGRGGKVITVTNLNDRGPGSFRE
ACETGGARIIVFNVAGIIRLESPIIVRAPYVTIAGQTAPGDGVCIAGESFWVDTHDVVVR
HMRFRRGETKVWHRDDSFGGNPVGNIMIDHCSCTWGLDENISFYRHMYDPSEGQYESKGL
KLPTVNVTIQNTISAKALDTYNHAFGSTLGGENCAFARNLWASNSGRNPSIGWNGIFNFV
NNVVFNWVHRSSDGGDYTAMFNMINNYYKPGPATPKDSNVGHRILKPEAGRSKLDHKEYG
RVYADGNIMEGYPEITKDNWNGGIQIETQPNTDGYTEYMRSYQPFEMPYINIMGAKDAYD
YVLKHVGANIPCRDIVDERVIEEVRTGIPYYEKKLPKDAYGDLTGLSPKSMGEDGQFKYR
RLPKDSYKQGIITDVRQMGGYPEYKGTPYVDTDKDGMPDEWEIANGLNPNDPSDTNKDCT
GDGYTNIEKYINGISTKHKVDWRDMKNNYDTLAEKGKLM

Enzyme Prediction     

No EC number prediction in MGYG000001378_03748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	135	328	3.1e-64	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	0.002	511	532	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69947.1	0.0	1	579	1	579
QRQ56886.1	0.0	1	579	1	579
ALJ45257.1	0.0	1	579	1	579
SCV09593.1	0.0	1	579	1	579
QUT29068.1	0.0	1	579	1	579

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	1.55e-48	85	558	23	420	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	2.15e-48	85	558	23	420	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	4.04e-48	85	554	22	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	2.01e-46	85	554	22	413	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	2.84e-46	85	558	23	420	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.998976	0.000212	0.000177	0.000172	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_03748.