CAZyme Information: MGYG000001378_04035

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_04035
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	MGYG000001378_9|CGC4	53707.5	7.8118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 148452; End: 149864 Strand: +

Full Sequence      

MKNSIVILFLLLLSQLGYGQGRTFKVTARPWVKGQKDLPWKEYDTRTIAQLDGFKATDKV
HVNEYGSDLDAPKHRATGFFRVERIGNRWWMIDPDGYRHLQKVVVGVRLGTSERNKQAML
DKFGTEEKWIERTAQMIHSLGFSGTGSWSNEEAIASYNASHKEVLTRSIILNLMSGYGKK
RGGTYQLPGNTGYPNQCIFVFDPEFETYCDEMAQKLVANKMDKNIIGYFSDNELPFGPKN
LEGYLTLQNPGDPGRVYAESWLKKQGITSQQITDEHREEFAGVVAERYYKVVSEAIRKYD
PNHLYLGSRLHGKPKFIRQIVEAAGRYCDVVAINYYGAWTPSEKTMKHWGEWAQKPFIIT
EFYTKGMDSGLANTTGAGFTVQTQQERGYAYQHFVLGLLESGNCVGWHWFRYQDNDPTAK
GADPSNLDSNKGLIDNEYNLYKPLADAMKELNINAYRLADWFDQQSNNNQ

Enzyme Prediction     

No EC number prediction in MGYG000001378_04035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	116	456	1.3e-84	0.552833078101072

CDD Domains     

MGYG000001378_04035 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71934.1	0.0	1	470	1	470
QNL39156.1	0.0	1	469	1	469
SCV06348.1	0.0	1	470	2	471
ALJ46941.1	0.0	1	470	1	470
QRQ59048.1	0.0	1	470	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	1.42e-90	37	464	52	481	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	8.30e-30	48	456	233	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	2.01e-29	48	456	233	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	1.01e-25	63	456	264	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.08e-20	47	456	248	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	8.63e-25	18	458	435	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	3.45e-15	119	456	547	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999219	0.000150	0.000142	0.000135	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_04035.