CAZyme Information: MGYG000001378_04564

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_04564
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1233		140923.92	6.4838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 63233; End: 66934 Strand: +

Full Sequence      

MNRISKVFLACACSVFCMNGQAQSNATWTNDFSNAGETLKVVGRGTCSIADNVFRSKGAY
AVFGHPEWKNYSFSFKARAPKNAEQVQIWASFRNYNRFDRYVVGIKGGLQDDLYLMRTGY
MGTDEFMGVRPLGFHPVPGEWYRVKVEVCGNRIRIFLNDEKQPHIDLVDKNADLVPSGEV
ALGGGWIETEFDDLTVTPMADDALKNVKVAEYQKKPTPTEKENKRRQERASYTSAKLAAL
TGSRTDITLDGNWLFMPDYQLDNKDKAVSVQTNDQDWHIMSVPNFWTPIRIWLHGETMPS
PTGAQPKGVSDTYYQQETDRCENYTFDYRRVKYAWYRQWLELPANVEGKNMTLTFDAVSK
IAEIYINGTLATSHLGMFGEIQVDGSRLLKPGKNLITVKVIRKMDGSASESANAIDFFYS
SVRESEQEDAKVEVNKDALLKEIPHGFYGDEPAGIWQPVKLTITDPVKVEDVFIKPTLNG
ATFDVTLKNHGSKKKQFDLYTDIIDKETGAVLYSGLSIRKLNLNADEERMETYTISDLKP
RLWTPQHPNLYDFKFRLVADKRTELDCLTETSGFRTFEVKDGLFYLNGNKYWLRGGNHIP
FALAPNDENLANTFMQLMKAGNIDVTRTHTTPWNKRWMTAADRNGIGVSFEGTWSWLMIH
STPIPDQRLIEIWRNEFLGLLKKYRNHPSLLFWTVNNEMKFYDNDSNLERAKEKYRIISD
VVKEMRRIDPTRPICFDSNYQAKGKDKKFGADFMSSIDDGDIDDMHGYYNWYDYSVFRFF
NGEFQKQFKVADRPLISQEMSTGYPNNETGHPTRSYQLIHQNPYTLIGYESYDWADPASF
LKVQAFITGELAETLRRSNDQASGIMHFALMTWFRQTYDYQNIEPYPTYYALKRALQPVL
VSAELWGRNLYAGEKLPTRIYVVNDREDGTDLQPSLLRWEIQDESGKCLASGSEKIPAVK
HYARYYAEPDIQLPANLPADKTKAKLVLKLTENGLPISANEYELLLTNKEWNVGQVDPNK
KIVLLDKDNTKTVFDFLNINYQPISSIKELLNSKLKADLCVISGLTACTDEEKELIRAYQ
SKGGKLLFLNSKEAVKAIYPEYITGWIIPTEGDIVIMERNDAPVFNDIDVLELRYFNNNK
REIPQACTATLKVHRHKNVTELAGQMKIHAYIDGGKPEDRIERIESMRGLTMLQIADGKG
EAMISTMCTEKATTDPVAGKLVVNMINCLTTNK

Enzyme Prediction     

No EC number prediction in MGYG000001378_04564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	228	999	3.2e-83	0.7446808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.25e-32	240	747	6	459	beta-D-glucuronidase; Provisional
COG3250	LacZ	9.32e-29	335	734	66	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.33e-21	336	746	113	484	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	5.93e-13	467	575	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	1.28e-11	577	799	1	209	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT71556.1	0.0	1	1233	1	1233
QIU96993.1	0.0	1	1233	1	1232
ALJ60854.1	0.0	1	1229	1	1227
QDO68995.1	0.0	1	1227	1	1225
QUT88128.1	0.0	1	1229	1	1227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.72e-24	247	698	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.72e-24	247	698	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ED1_A	2.08e-21	245	772	25	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6U7I_A	4.47e-21	304	775	40	476	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
3GM8_A	6.65e-20	267	734	24	421	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.59e-23	247	698	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	2.80e-20	327	731	53	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q04F24	3.05e-18	244	708	45	467	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
O52847	3.05e-18	248	698	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
B4S2K9	2.06e-17	336	698	124	460	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000597	0.888600	0.109916	0.000327	0.000285	0.000245

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001378_04564.