CAZyme Information: MGYG000001378_04782

Basic Information

• Species: Bacteroides ovatus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ovatus
• CAZyme ID: MGYG000001378_04782
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	MGYG000001378_13|CGC5	69690.65	6.4231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001378	6545242	Isolate	not provided	not provided

• Gene Location: Start: 165069; End: 166928 Strand: -

Full Sequence      

MKKTFTYLSFIIFLGWFPSLFAGEIYVSLQGNDKNPGTKEAPFNTLNRAIKQAREWRRLN
RPEVAGGIYIRLEEGVYAQRNSLFLRPEDSGTPDSPTVICAVDGAHPVISGGVAVTGWKR
GCNHPAIPEKLKQKIWSVEAPLIGNRRVETRQMWVNGHKVQRAAQFPDGGLERMIDFNPE
EQTITIPVSQSVNPKRLQNAGQLEMIVHQRWAIAILRVKSIDVKDGQAVVRFHEPESHLE
FAHPWPQPVIGGEKGNSSFCLTNALELLDQPGEWFQEYPSGTIYYYPQASENMETAEVII
PTLETLVTIDGTLSRPVKHIQFNGITFEHTSWMRPSYQGHVTLQGGFPLLDAYKLQEPGL
PEKAELENQAWITRPETAIRVRGAEHIDFKHCTFRHLSSTGLDYEWAVTASSVEDCQFTD
IGGTALLVGAFPDGGLETHIPFIPADVRELCSHITIRNNFISNVTNEDWGCVGIGAGYVR
NMDISHNEVCHLNYSGICVGWGWTSLESGMCNNRIEANYVHHFARRLYDAGGLYTLSNQP
GSVMRNNRIEHLIEAPYATNDRAFYIYLDEATDGYTMENNWCPAERFDSNRPGKKNVWKN
NGPQVADSIKYKAGRIKQD

Enzyme Prediction     

No EC number prediction in MGYG000001378_04782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	24	585	1.4e-217	0.9943074003795066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.29e-06	377	580	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam07602	DUF1565	0.001	31	116	3	100	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.
pfam05048	NosD	0.008	372	520	37	154	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69667.1	0.0	1	619	1	619
SCV09204.1	0.0	1	619	1	619
ALJ44867.1	0.0	1	619	1	619
QRQ56538.1	0.0	1	619	1	619
QUT22974.1	0.0	1	619	1	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.08e-191	20	614	22	614	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000477	0.998705	0.000236	0.000177	0.000181	0.000178

TMHMM  Annotations     

start	end
7	29