CAZyme Information: MGYG000001379_01244

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_01244
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	MGYG000001379_3|CGC2	94523.5	5.2495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 86843; End: 89245 Strand: -

Full Sequence      

MKYENIVKCQFSTKTEREMHFHQDIEILYVLDGSLEVEYEDGTHFLNTDQFILVNSNVRH
AYHTEGELLLGSLFIDYTMLTEIFGGEHLFFWCNSAEERSESYDKMRYYIRQIFNYYQTT
EGQGIALKNSIYYQLIYLITTDFIVKKGMKQYDSLRGIQDERMNEIMSYIMSNYREPITL
KGLADRLYLSHTYLSKYIKQNFGMSFLKLLNNIRLEHAVSDLLYTDKTVIKIAMENGFPN
QAGFNNAFREIYHCTPAEYRMEMLEKREKSEQPENSEQIMERVEQYLTYNLISSPESGDS
TVRELEIDVTKKELTERNWCKLINVGTASELLRFDVREHIKYLVEMLHFEYVRFWNLLSD
DVMIEIKERNTRYNFKIIDQIFDFLMEIGVKPHVELGFKGREYVVGRVERKMLSLDIRSQ
ISLIGKNRGFLEELIKHLVRRYGISEVERWHFELEQNAVIQEKVEIESYFEAFDAVADIF
RTYAPGVKLGGAGFSMNYIAEELPSILRKWKKRRQQPDFISIYSYPYLLKEHLLDAGRNP
YSPDESYLYHQVQRIKEILVEEDFPTKELYVTEWSSTLSNRNCLNDGCYKSAYIVKNLIQ
NYGQADMIGYWSATDIFAERIDSEALLFGGCGLITRDGIRKPAYFAFEHLNNLEKYYYGK
GQYSLVSGNGKDLFYICCHNYKHFNFRYYSLNEDEIEEEQQPRLYADNESIQLSFRLKNV
NDGIYQIKVFSVNQENGNVQNEWKKLDYFNDLSVKEIEYLKMTCQPKLTIRKAEAVDHVL
VVETKLTAQEIQGIVISEMP

Enzyme Prediction     

No EC number prediction in MGYG000001379_01244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	315	746	6.2e-70	0.9721577726218097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.03e-42	310	786	10	477	Glycosyl hydrolases family 39.
COG3664	XynB	2.71e-34	331	791	1	419	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	3.33e-26	160	260	19	119	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.00e-23	177	260	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	4.80e-22	183	260	1	79	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF58080.1	6.55e-202	4	797	8	799
AQR96769.1	2.34e-199	4	797	8	799
BBG22497.1	3.64e-154	4	799	7	808
AQR96727.1	1.31e-150	4	792	4	786
QIB55960.1	1.77e-137	1	791	1	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	1.68e-40	323	791	28	491	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	3.08e-40	323	791	28	491	ChainA, Beta-xylosidase [Caulobacter vibrioides]
2BS9_A	7.00e-35	312	799	11	483	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	2.30e-34	302	799	1	483	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BFG_A	4.15e-34	312	799	11	483	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	1.01e-32	312	653	11	360	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
O30360	5.66e-32	308	786	8	469	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P23552	1.58e-31	319	653	24	356	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P36906	1.08e-30	308	667	8	371	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q936F1	4.06e-28	29	800	27	743	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_01244.