CAZyme Information: MGYG000001379_01451

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_01451
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000001379_3|CGC8	54841.01	5.4036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 287471; End: 288892 Strand: -

Full Sequence      

MNTKLKYITPAKSFTEALPLGNGSLGAMVYGGVPEEHITLNHDTFWSGTGRRPEKEIDAK
ILGHARELLFEEKFWEAEQFIKEHMLGFYNESYMPLGELNYRFEEIGEIEQYSRNLDLEN
AIFSSEFCSKNTLYQTEVFISYPAKALILRMKVSGSEKLNLSVNLNSKVRHDMKAEVSQD
LYIFGNAPSNVQPNYLTCDHPITYDEQNPGMAFGCYLHIENTGGEVTALKDELKVKNADE
VLFYLTAEDGYRGYKKRIEKDPEVCITQCRKSLEILKNRDYESLKQEHIIDYKSVYKDVR
LELEKEESDMPLDQRLAEFRNGKQDLGLLCLFFHYNRYLMVASSRKGSQPANLQGIWNES
IRPVWSSNWTVNINTEMNYWMNGSCNLLDSYLPFVEFVSELSDAGKETARKQYHCSGWTA
NHNVDIWRQTGPVAGEPKYAYWPMGGIWLCAQSYEYFKYSKDIEYLKQKFSLR

Enzyme Prediction     

No EC number prediction in MGYG000001379_01451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	3	469	3.5e-136	0.6080332409972299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	4.51e-59	5	253	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT29806.1	5.78e-158	1	469	1	468
AXB87222.1	5.49e-131	1	472	1	476
QMW92850.1	8.54e-130	1	472	1	476
QJU46727.1	8.54e-130	1	472	1	476
QCJ08485.1	8.54e-130	1	472	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	4.70e-98	4	467	4	471	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	3.95e-79	4	472	42	492	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
4UFC_A	8.63e-77	4	472	23	471	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAB_A	1.56e-32	18	472	52	534	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.56e-32	18	472	52	534	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.92e-68	4	469	53	530	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.75e-38	15	468	36	486	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	1.41e-31	20	466	46	503	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.92e-26	16	437	31	452	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_01451.