CAZyme Information: MGYG000001379_01466

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_01466
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	MGYG000001379_3|CGC9	55908.68	4.386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 301118; End: 302617 Strand: -

Full Sequence      

MSIELTLNPEKLEAIREMDPRVQSYNIEMTELTGGTFWVPYTPEQISGEEAFPTCDKMED
MMKMLAGMQTKVPAINLYDEKIRSFAKAFGPVVIRFSGSWATRTYYDFDGHTGGKAPEGF
EFVLTKEQWQGALDFVKAVNGQILVSVANSFGVHEDHTGAWMPEQAEILWKYTEEQGMKI
EYAEFMNEPNMLNGMCLPDGYTLDDYGRDYDLFAKWLRENHPETKLVGPCSAENERGAAA
GGMAALLLGTEDIMKRCKEAPDYYSYHSYNGISERGQMFGAHFDFDAVTSEYYLGATMED
LHYNETIRDKYAPGAEMWVTESADAACGGNTWGPTFVETIRYVDELARFNVNTKGIIFHN
TLASSAYGLLDADTHMPRPQYWGALLYSRLAGTTVYDTKEEIREGAHVYAQSRKDGEKGF
CYVIINNSREEETLVHVPACVQYTLSADSLRSQEIKLNGNVIASGEDGTIPELKGEEKEA
GTITLAPCTVTYLVVGDER

Enzyme Prediction     

No EC number prediction in MGYG000001379_01466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	75	495	1e-67	0.9406593406593406

CDD Domains     

MGYG000001379_01466 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	1.13e-155	7	495	7	509
SNU86930.1	6.62e-149	5	495	5	507
AXI08463.1	2.99e-141	5	495	5	504
QGS68324.1	2.99e-141	5	495	5	504
SQG46560.1	7.99e-140	1	495	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	7.97e-11	159	482	41	364	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5E8M_A	4.18e-08	161	499	45	384	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5LA4_A	5.35e-08	161	499	165	504	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5L9Z_A	9.77e-08	161	499	45	384	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FF10	2.81e-18	87	455	87	454	Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
Q8L608	8.17e-15	75	451	72	446	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
Q9LRC8	7.67e-14	75	493	73	510	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
X4Y2L4	9.22e-14	75	497	40	481	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
B2RY83	3.98e-10	123	495	187	581	Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_01466.