CAZyme Information: MGYG000001379_01787

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_01787
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815	MGYG000001379_4|CGC4	93840.48	5.9965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 160857; End: 163304 Strand: -

Full Sequence      

MKNKFIATTYRFHTKDKNKFLVIGWFRENTIGNNELRVCLDKKKIHFTMEEKDFVGGAVK
ALDGLKVTKQYFLWIDLPKGWEACRNLQVMNFYEGEGGPALEISTKRLQHLQGKMAKYID
GGNLLSTGFRVSGWYIDDGTVELGLFDKSGKKYDAEIKRKRRSDVQKLYPENSADEIVGF
EAVYKGDAPKKVIVHLESSTKKADFPITLVYSPLEKGAELFDKYYRKARAYYQQFGFKET
VKRSIEKITVQDSINYKAWIRRNAPTAKMLQAQREAHFQYAPKISIVVPLYKTPENYLRE
FVQSVQAQTYKNWELCFSDGSGKDSPIEGVLNELTHKDPRIRVVYTGEQLQISENTNEAL
KIAAGDFIAFSDHDDLLAPDALYECVKALNEDRSIELLYTDEDKVDMKGKEFFMPHFKPD
FNIDLLRCNNYICHLFVVKREILEQVGMLNPEFDGAQDYDFVLRCVEKSEHIHHIPKILY
HWRAHKDSTAENPESKEYAFIAGGRAVQAHYARVGIDAEVMQTEYKGIYRSKYHLHGEPL
ISIIIPNKDHTEDLEKCISSIENKATYKNVEYIVVENNSEKEETFAYYKELEKKNPKAKV
VFWDGTGFNYPAINNFGVEKAGGEYLLFLNNDTEIVNEDCLEELLGYCMREDVGAVGARL
YYEDGSIQHAGVIVGLGGVAGHAFTDFPHESPGYFGRIVMAQDYSAVTAACMMMRKNVYE
EVGGFDPQWAVAFNDVDLCLKIRKAGYLIVYNPYAELMHYESKSRGYEDNEEKVERFNSE
IDNFMRVWKEFLDQGDPYYSPNLTLDKNDFSLRVK

Enzyme Prediction     

No EC number prediction in MGYG000001379_01787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	446	3.9e-23	0.9882352941176471
GT2	542	723	5.2e-20	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.22e-103	282	484	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	3.81e-42	543	761	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.42e-31	537	766	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	3.98e-23	285	489	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.63e-20	285	443	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB25117.1	0.0	1	814	1	814
QEI32629.1	0.0	1	814	1	814
QRT31219.1	0.0	1	814	1	814
QUO33456.1	0.0	1	814	1	812
QRT49543.1	6.19e-318	1	812	1	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.08e-06	284	389	7	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.17e-146	226	812	307	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.81e-104	255	813	292	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.25e-16	282	483	8	212	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q7BLV3	1.55e-16	275	663	433	841	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q9CMP0	2.67e-16	275	490	426	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_01787.