CAZyme Information: MGYG000001379_02162

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_02162
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	MGYG000001379_5|CGC1	93700.91	5.6334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 157504; End: 159885 Strand: -

Full Sequence      

MRENGVQLQIRKKIKEEISFLPDVRLYYIIEGMLEVQIEKKCYRMKKDDILVINVGVRAG
KIETYESDALICELCFENRILAELLENENGRFVCNSVEHPGQSYERLKKIIQQILRQRGL
NLHKTKSYEYSLIYQLLDELIEHYWIVNSELQVSREVTDPRLEEILRYVHCNHSAHISLA
EVAEKLYVSTSTLSRFFKKQTGMYFAEYVGKIRLHYAENELKNTSHSITEVAMHCGFSNV
QALNKVFREKRQMTPTEFREQWTKRKKREEEDWKETVRQDLQKTEWFYEMQENAVDQIRI
DTSGQSESRLPKIWKRAINIGSMHRLGEVNIQFQTQRLVNELGFTHVRVWNIFSEPLMIT
DGKRVGNYNYDKIDQIMDFLAANHIALYLDFSRRMDAALISEGEPLYYKEEHIAFDSKEL
WESLLIDFLSHLSKRYGKSEVENWIFELADFEDGILLEPTGFYDYYEMYRFFYRAVKREF
PNAKVGGYSAPPGQEKSAFPKYLRYCRKNDCVPDFVAVMIFPYEAGENAAGYRRVAEDHW
EKNLLLYYRKCMEAENLSSCELYVSEWNMSLSNRNFLNDSCFRSAYFVKMISEIYELTDM
ICLWFGSDWISNYYDARSMVNGAGGILTKDNIKKPIWYALSFLNQLGEELLAVGEHYLIT
RRNNESYMILCFNFKQLGVSYFYIKENEVSLGQIRELFENSDSIQVDIQLENLTIGETYI
VKKRQINSEYGCVLTEWAKMGMAVDLERSDIKYIEGRCVPNLEREQRKAEAGNVEISCEI
RDQEMILYHIYPK

Enzyme Prediction     

No EC number prediction in MGYG000001379_02162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	308	742	1.1e-56	0.9814385150812065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	4.59e-29	334	790	37	487	Glycosyl hydrolases family 39.
COG2207	AraC	3.08e-26	155	261	15	121	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	3.43e-25	177	259	2	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	5.80e-21	182	261	1	81	Helix-turn-helix domain.
COG4977	GlxA	1.74e-19	149	266	209	326	Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ92191.1	2.09e-217	8	791	9	797
QJU15301.1	2.09e-217	8	791	9	797
ASU27451.1	2.38e-217	8	791	13	801
ANU74646.2	2.38e-217	8	791	13	801
QGH26007.1	2.91e-176	5	791	10	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	2.46e-32	332	792	44	498	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	4.43e-32	332	792	44	498	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6UQJ_A	3.17e-28	339	792	56	505	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
1PX8_A	7.01e-28	298	790	2	479	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6YYH_A	6.68e-27	294	790	22	502	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36906	1.64e-26	298	790	2	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	2.20e-26	298	790	2	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P23552	2.77e-20	304	752	14	446	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q00753	8.36e-12	19	261	32	274	Msm operon regulatory protein OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=msmR PE=4 SV=2
Q65Q30	3.58e-11	111	265	123	276	HTH-type transcriptional activator RhaR OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=rhaR PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_02162.