CAZyme Information: MGYG000001379_02213

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_02213
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000001379_5|CGC2	77242.48	4.5274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 214652; End: 216739 Strand: -

Full Sequence      

MRATKEYRLKVTEEAQKIVDQLTLEQKVSLMSGSIVDLNKVTQEQIMEMMGGMLSDDNHY
NMTPYPAGGLEEHNVPPMLFVDGPRGVVCGTGKSTCFPVSMARGATFSPELEEKVGNCIG
REVRAFGGNLFAGVCINLPYNPGWGRSQETYGEETYQVGKMGAALVKGVQDEDVMACVKH
YAFNDMENARFKCSVTCDQRTEQEVYLPHFKDCIDAGAASVMSAYNRYNGVQCGHHKYLL
SQVLKKEWDFDGFVMSDFCWGVLDTVEAANGGQDMEMMWTQYFGERLVKAVQDGFVPEER
INDAALRIVRTILAFDKDHKEYDMSVVGCPEHIAVAKEVAEKAITLIKNDGVLPLKREET
KKLALIGKLANTAIIGDHGSSWVRPPYVVTPEDGLKKANAECEVIFDDGSDLERAKKLAA
ESDAVVFVVGYNYDDEGEFISGDQASNYTGAMGGDRKRSLGLHEDEIKLLQEVGPVNEKS
AAVLVGGNMIMMTEWYDKVNAVIMAYYPGMEGGTALAEIIYGDVNPSGKLPYVVPYSEDD
LPHVDWEATDQYYEYYHGYTRLEKNGVKPLVPYGFGLSYTTFDITDPKAVVDGDELKVTV
NVKNTGAIDGDEVVQVYVGFENSAVDRPVKQLRGFRRVSLKAGEEKEVEITTPLEKLKWY
DPVYREWKLEKMEYPVYVGSSAAEEDLVKTAVTIS

Enzyme Prediction     

No EC number prediction in MGYG000001379_02213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	72	278	8e-60	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.90e-89	92	661	115	734	beta-glucosidase BglX.
COG1472	BglX	1.42e-60	74	401	59	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.44e-59	9	651	47	741	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.33e-49	344	579	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.58e-42	75	310	66	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS06558.1	0.0	1	694	1	689
AJH00797.1	0.0	1	694	1	689
QUN34009.1	0.0	1	694	1	689
AVK47794.1	0.0	1	694	1	689
QES74816.1	0.0	1	694	1	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.13e-102	36	684	3	659	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.17e-85	13	682	2	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.67e-84	13	682	2	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.26e-82	11	684	1	654	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.07e-75	12	684	51	819	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.81e-101	36	684	3	659	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A7LXS8	1.12e-95	60	684	63	736	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
E7CY69	3.74e-81	11	684	1	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	7.22e-81	11	684	1	663	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q0CEF3	4.82e-78	34	684	32	727	Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994982	0.005013	0.000027	0.000007	0.000004	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_02213.