CAZyme Information: MGYG000001379_02797

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_02797
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809	MGYG000001379_8|CGC1	91090.5	4.6353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 13355; End: 15784 Strand: -

Full Sequence      

MRIQKWNENWKFWADKDSFALVWNVPENARTINLPHDAMIEEKAYAESGNHGNTGFRDGG
VYTYVKHLFVGEDAKEKTMMLKFEGIYMNAMVYVNEQLAAKNMFGYTTFYVPLNDFLRYG
QENEIRVQVRNNNMTNSRWYSGTGIYRDVYLLESGLDYLVPEGVQIKCETADEEYAVLQI
RSEVKNRKLIPAEMTLHTVIRNEKGDAVGEEKTVAVLFDQEQRELTQRIVIGKPEFWSAE
TPILYTCEATLMMGEEVVDAQTEKFGIRTMSLDAKRGLRINGESVKLRGACIHHDSGLLG
AATFEDAQYRQVAKLKEAGFNAIRMSHHPMAPAMLRACDELGMYVMDETFDMWDRCKSDL
DYGLYFREWWEKDVTAMVRKDYNHPSVILYSVGNEIPEIGTDHGAKTCHELCEKIKALDE
TRYTLASINGVFAAGDQVDNIVADVSADLCAKGELDGNVNDFMTLMDDHMDEIVVHHAIT
ERLEKACASTDIAGYNYMTARYEMDGELYPNRVIVGSETYPPEIARNWDLVEKLSHVIGD
FTWTGWDYIGEAGVGVPAYQWGEGGFGAGFPCQLAYSGDIDITGFRRPASYFREVVFGLR
KDPYITVQNPHKFGQHLIKTPWVISDSVSTWNWSGCEGNPAIVEIYSPGEEVELFVNGVS
QGKKAAGKNAGFRTLFEVVYEPGTVEAVAYENGQEIGRMELQSAESEVHLELEIEGGRAK
ELSYIHVWLKDSQGRVMTDCDKKLTAEVTGDADLAGFGSGNPKPEHNYNEGITETFHGHA
LLILRKSEGTESCQVKIKSEDGLSVEASF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	593	4.8e-99	0.6090425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.93e-63	1	423	10	428	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.96e-36	57	445	61	466	beta-D-glucuronidase; Provisional
PRK09525	lacZ	3.53e-30	113	422	174	483	beta-galactosidase.
PRK10340	ebgA	5.40e-30	64	422	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	2.43e-21	638	698	1	61	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF42782.1	0.0	8	806	8	813
BBC61768.1	0.0	1	801	1	801
BAL62913.1	0.0	1	801	1	801
QBE95487.1	0.0	1	786	1	796
SNU91084.1	0.0	1	786	1	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	3.46e-141	1	799	5	767	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.76e-141	1	799	5	767	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	2.91e-101	2	788	8	784	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	8.80e-101	1	788	1	778	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T9A_A	4.70e-99	7	788	33	822	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.40e-101	7	801	48	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	8.20e-76	7	785	52	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.65e-31	28	664	78	675	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.13e-30	7	756	20	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	1.50e-24	7	799	32	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000022	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_02797.