CAZyme Information: MGYG000001381_00831

Basic Information

• Species: Neisseria macacae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria macacae
• CAZyme ID: MGYG000001381_00831
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001381_2|CGC1	41888.4	7.5623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001381	2684306	Isolate	not provided	not provided

• Gene Location: Start: 281; End: 1387 Strand: -

Full Sequence      

MSLAQPNRILVIKLRHHGDVLLSTPVVDAIKQHFPECEVDMLVYQETADIIRDNPQIARI
FTIDRQWKKQGVRMQFKHEKDLFRQLKARQYDWAFNLSDQWRAAIIAKLCSKCSVGFNCI
KRDNAAWRWCHDFLNPDMGTTKHIVETHLGILPPLIRPEELSHAKVRMSISLDVRNSMEQ
KLREQGWQGENYVLLHPGARWLFKCWEDGKNAALVQLLLNHGHNVVLTASSSPVEHDMIE
AILGRLKIPEGGKVWVLSGCLTLRELAAAIDRAKLFIGVDSVPMHIAAALDKPQIALFGA
TWLGIWHPYSLNAEVIWAGDYTDLPHPDSINTNNPERLLKAIPLEEVWNRVSAKLEKIDQ
TGTHAATE

Enzyme Prediction     

No EC number prediction in MGYG000001381_00831.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	81	322	9.3e-46	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02201	heptsyl_trn_III	9.27e-118	8	347	1	335	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	4.95e-79	6	347	5	335	lipopolysaccharide core biosynthesis protein; Provisional
COG0859	RfaF	1.77e-65	8	357	3	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.15e-62	8	351	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.85e-31	82	318	4	229	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT36916.1	3.52e-276	1	368	1	368
QXW91120.1	2.28e-192	1	359	1	359
QXW95550.1	2.28e-192	1	359	1	359
QTM23302.1	2.36e-192	1	355	1	355
AVR78051.1	2.36e-192	1	355	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	7.46e-11	8	315	2	296	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	7.46e-11	8	315	2	296	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	7.82e-11	8	315	2	296	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	2.71e-10	7	320	9	309	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	4.84e-06	197	316	187	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	5.25e-61	14	363	1	338	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	3.90e-58	14	347	1	323	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	1.83e-11	6	298	8	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P24173	1.62e-10	8	340	2	315	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P37421	8.42e-09	8	316	2	305	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001381_00831.