CAZyme Information: MGYG000001381_01655

Basic Information

• Species: Neisseria macacae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria macacae
• CAZyme ID: MGYG000001381_01655
• CAZy Family: GH77
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1436	MGYG000001381_4|CGC1	163090.37	4.819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001381	2684306	Isolate	not provided	not provided

• Gene Location: Start: 224307; End: 228617 Strand: -

Full Sequence      

MSEHLEEQAAGLGIDLGFHDIGGIYHATKPEVLEGIIKALQQDGFSDDLYADTLVAHENG
RESLQLPAEFHDAAEICLEDEAGGRQVLPLNHGEDGVLWVALPALACGYYTLSEEVEGSV
RKVRLVVAPQSVYQPKMLEHGLRMNGLTTHLYSLRSQRNWGIGDFTDLLDLMAFAADKQL
DFVGINPLHALFSAKPAFASPYSPSSREWLNPIYLDVEKVGALSYNEKLKNWLKQPNICQ
RIAALRITETVAYTAVWAFKRDALQRAFDAFENDGCEAAEQERAAFDAFAEERGEALEGF
GLFEALDQYYNCSGEVGWLSWPSEFHDPHGEAVQRFAQGHRHEIRFYMWLQWLCAEQLRE
VNEAAEARGVKLGIYGDLAVGVARGSADTWLNRADYCMDMAVGAPPDPFSPTGQNWDLPP
LNPMMLKHTGYEKFVRLLRENMRLYGILRIDHVMALCRLWWVAGKTADFGAYVHYDADVM
FAILALESRRNQCVVIGEDLGTVPDQARYLLNRYQVFSYKVVYFSKGWHGFEWPEEYPEQ
AITVVSTHDVAPLAGYWTGKDLDLMFRLGTIPDAETFQTTLEAREHDKADLFDKLKHAGC
LPADAEMSSEIDETLLTALHRYAAMSRSKLYAVQLENLLGMSDNLNVPGVSEGYPNWARK
MPVALEDFPHNRLIGGQLAMIGEVRMKKNSRMKPYHELDQVERDTVESLFLATHSDLFAY
LGRHRLAEGDEVVRTLIPNAWGVDIVNRETGEVITSSEKVDERGFFVAVLPEGAPDYALN
VRYAEDAEPVREEDPYRFGSALKDMDSWLLAEGKHLRPYETLGAHFAEVDGVKGVSFAVW
APNAQRVSVIGEFNHWDGRRHVMRFHRDNGIWDIFIPAVKLNALYKFEIRDANGDVRQKT
DPYAFGAELRPNTASVVRGLPEKVETPDFRARANAIDAPISIYEVHLGSWKRNPENNFWL
TYEQLAKELVAYVKDMGFTHIEFLPVSEYPFDGSWGYQATGLYAPTSRFGSPDELRALIK
AAHDAGIGVILDWVVGHFPTDDHGLAKFDGTALYEHADPREGYHQDWNTLIYNFGRNEVK
NFLQGNALYWIERFGFDGIRVDAVASMIYRNYSRKDGEWIPNQYGGHENLEAIAFLRDTN
TMLKEVVPSATEIAEESTSFANVTRQEGLNFSYKWNMGWMNDTLRYMMEDPINRKYHHNK
MTFGMMYQYSENFVLPLSHDEVVHGKRSLLGRMPGDCWQQFANLRAYYGFMYGFPGKKLL
FMGNEFAQGREWNYNEGLDWFLLDQEGGWHKGVQNFVRDLNRVYKDTAPLYQLDQWPEGF
EWLVADDGNNSVFVFERRDREGNRVIVISNFTPVVHDSYRFGVNEAGEYREILNSDDPGY
NGSGVSAGQILQTEEIWSHGRPNSLAVKVPPLATVYLYKAAEPRATEVADQEEGEA

Enzyme Prediction     

No EC number prediction in MGYG000001381_01655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	972	1268	3.4e-153	0.9933554817275747
GH77	150	673	2.3e-148	0.9676113360323887
CBM48	821	905	1.1e-18	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11052	malQ	0.0	1	674	2	682	4-alpha-glucanotransferase; Provisional
PRK14705	PRK14705	0.0	700	1421	502	1224	glycogen branching enzyme; Provisional
PRK14507	PRK14507	0.0	1	679	4	718	malto-oligosyltrehalose synthase.
PRK12313	PRK12313	0.0	799	1417	4	625	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	797	1418	1	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT38925.1	0.0	1	1436	1	1436
AVR78910.1	0.0	1	1436	1	1436
ARC51742.1	0.0	1	1435	1	1435
QTM24140.1	0.0	1	1436	1	1436
QKI21631.1	0.0	1	1421	1	1423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	6.98e-307	809	1422	1	617	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	2.09e-304	815	1422	2	612	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	2.29e-233	696	1417	20	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.55e-232	696	1417	20	771	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	7.03e-232	696	1417	20	771	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TC27	0.0	699	1422	3	728	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=glgB PE=3 SV=1
Q4QK67	0.0	701	1417	5	725	1,4-alpha-glucan branching enzyme GlgB OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=glgB PE=3 SV=1
Q3YW93	0.0	699	1422	3	728	1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) OX=300269 GN=glgB PE=3 SV=1
Q1R5J4	0.0	699	1422	3	728	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=glgB PE=3 SV=1
Q65TI0	0.0	701	1417	5	725	1,4-alpha-glucan branching enzyme GlgB OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001381_01655.