CAZyme Information: MGYG000001384_00554

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_00554
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000001384_1|CGC4	58842.27	7.9427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 591176; End: 592855 Strand: -

Full Sequence      

MVKQADAIWGGLIGRAAFVGAFVLFGGVWQAAIAQPSGADGGDFVYRVQQGDTLINLSER
YMDSVEGWRLLQRRNHVADPYRLKPGSLLRIPFDRIPVVPATAQVVFARDATTGGKPLQT
GTKLAEDAQIDTGDKGAVTLAFDDGTRVTVPPGSHVALSRVRAFARAGLIDVRVHVKKGE
AESNVAPKKSGVGRYEISTPALVTGVRGTRFRVQASEAGSTSSVLEGEVATSAGRQRQAV
KAGFGVVASAGHLKRAALPAPPKLGAIPELVQTPCLRATWQPVKGAVGYRAAVARDAALT
ELSAYQSSKTPAATLCGDEDGDYTLVVQSVDALGLTSESATRPFTVRLHPEAPYTIQPAS
GRTYRSGDVAFAWAVVSDAGSYDMEVAGTESFASPAVQQHGEDVRLTRPLTAGTWWWRVR
SVAADGKTGPWSDALRFRVLDIPLDAVPTAEVEASDDGKLHAHWSALSPELAASGARTRV
QLAGDTSFAKPIADIVSDGNEATIPRPPSGVYYIRTGVDLGDAASVVYAKPQRIDVGAFV
GDSARSPVQSGGGNLLLND

Enzyme Prediction     

No EC number prediction in MGYG000001384_00554.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4254	COG4254	8.00e-99	39	393	1	338	Uncharacterized conserved protein, contains LysM and FecR domains [General function prediction only].
pfam04773	FecR	4.81e-15	128	229	1	95	FecR protein. FecR is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognizes iron dicitrate in the periplasm.
NF033165	lipo_LipL45	7.71e-08	119	232	62	174	lipoprotein LipL45. Members of this family are lipoprotein LipL45, as described in Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	2.13e-06	45	91	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.89e-05	46	92	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK34752.1	0.0	1	559	1	559
ANJ72833.1	0.0	1	559	1	560
ATG20285.1	0.0	1	559	1	559
ANH74359.1	0.0	1	559	1	560
ANA34433.1	0.0	1	559	1	559

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.139260	0.858258	0.001364	0.000492	0.000311	0.000300

TMHMM  Annotations     

start	end
7	29