CAZyme Information: MGYG000001384_02330

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_02330
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001384_2|CGC2	41075.94	6.9832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 282750; End: 283868 Strand: +

Full Sequence      

MSKHTKHRAKPAKGSLALVVIARDEAACIERCLMSAKPHVDRMIVLDTGSTDDTVAIAKA
CGAQVHHFTWVDDFSAARNAALAAANADWNLVLDADEWIEAGTEELRNACTFGPLLGVVC
IRSEYDISGHVEHSNSWIARLLPRGVRYKGRIHEQPVATAANLQRVRLPLVIGHDGYMNA
KLDRKRGRNHTLLQLELAAHPDDPYVLYQLGKDFEINQKDPAEAAAHYQRALARAPKVAP
YRHDLCICLLACLSKSKQLDSAITLAGEWMEEWSGSPDYFYMLGHLMFEAAAQDPAQAEK
QWLPMAENAFLKCLEIGEQPKLDAAVFGRGSFAAAKYLALTYRALADTLAIKSNQYSDIA
RQMQERSAAVAA

Enzyme Prediction     

No EC number prediction in MGYG000001384_02330.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.84e-38	16	201	2	205	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
TIGR04195	S_glycosyl_SunS	9.05e-22	20	252	63	302	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
PRK13915	PRK13915	4.13e-08	12	67	27	89	putative glucosyl-3-phosphoglycerate synthase; Provisional
COG0463	WcaA	5.08e-07	16	109	5	106	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04179	DPM_DPG-synthase_like	1.08e-04	19	67	1	55	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK37215.1	1.96e-275	1	372	1	372
ANJ75468.1	1.55e-242	1	371	1	375
ANH76116.1	2.20e-242	1	371	1	375
AXW82492.1	2.91e-180	13	369	10	363
AXV88308.1	2.91e-180	13	369	10	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSK_A	4.14e-22	15	220	67	278	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]
7MSP_A	2.25e-20	20	265	60	314	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	5.12e-20	20	265	60	314	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42460	2.84e-29	12	263	6	266	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
O31986	2.80e-19	20	265	60	314	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	2.80e-19	20	265	60	314	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
Q54435	1.30e-10	12	109	3	96	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1
Q9XC90	2.39e-10	16	157	5	147	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001384_02330.