CAZyme Information: MGYG000001384_02732

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_02732
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000001384_2|CGC8	85550.52	6.0936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 719217; End: 721523 Strand: -

Full Sequence      

MTALDFATPTKTAAQPEAPVVLPPGVDQMQVDVLTHGRLGDPFAVLGPHRLDTEDGPRWV
VRAFYPGARRVQAIDSRGQIITEMDPIGRTGLFHGPLRADAQDVYGHPELYRLRIIWPAG
TGHEAVQETEDPYAFGLLLGDLDLHLLNEGTHWALASCLGAQAMRLDGISGVRFAVWAPN
AQRVSVVGEFNQWDGRRHPMRLRHQAGVWELFLPSGLGAGPGARYKFELIGADGRLVVKA
DPAARQTEPPPATASVVADPAPLRWNDDAWMQTRAERHKPDAPISIYEVHAGSWLRDLED
GGRNLHWDELADRLIPYVTALGFTHIELLPVAEHPFGGSWGYQPLGLFAPSARFGAPEAF
ARFVDRCHQAGLGVIVDWVPAHFPTDAHGLAQFDGTALYEHQDPREGFHQDWNTLIYNFG
RNEVRGFLIASGLEWLERFHIDGLRVDAVASMLYRDYSRRAGEWVPNRYGGRENLEAVAF
LQQMNTVVHERCPGAITIAEESTAWPGVTAPVEFNGLGFDYKWNMGWMHDTLHYMQRDPV
YRQHHHDGMTFGLVYAFSEHFILPISHDEVVHGKGSLLGKMPGDEWQRLANLRAYLAFMW
THPGKKLLFMGCEFGQVGEWNHDASPEWHLLDDPRHRGVQRLVHDLNALYRNEPSLHARD
TAPEGFNWVIGDDRTNSVFAFLRLDGDGRPMLVVANMTPVPREGYRIGVPPAEGATHWRE
VLNTDAAVYGGSDFGNSGAVDVDHVAAHGQGQSLVLRLPPLGVVVLKV

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	316	616	1.1e-164	0.9966777408637874
CBM48	159	247	1e-20	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	148	767	16	626	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	159	767	27	620	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	8	762	489	1216	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	26	767	1	722	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	149	768	16	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK37618.1	0.0	1	768	1	768
ATG22552.1	0.0	1	768	1	767
AJW46989.1	0.0	1	768	1	767
QIF09336.1	0.0	1	768	1	767
ANA35351.1	0.0	1	768	1	767

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	5.03e-270	146	764	1	610	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	3.19e-267	151	764	1	605	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	5.93e-250	30	767	29	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.68e-249	30	767	29	772	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.68e-249	30	767	29	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4V0E2	0.0	24	766	7	720	1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=glgB1 PE=3 SV=1
Q63T91	0.0	27	767	7	736	1,4-alpha-glucan branching enzyme GlgB OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=glgB PE=3 SV=1
Q5H6H2	0.0	24	766	15	728	1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=glgB1 PE=3 SV=1
Q4ZTJ2	0.0	9	767	4	737	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=glgB PE=3 SV=1
Q881X0	0.0	9	767	4	737	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999935	0.000129	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001384_02732.