CAZyme Information: MGYG000001384_02933

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_02933
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		45172.9	7.6516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 938434; End: 939687 Strand: +

Full Sequence      

MQSIPRFLAGALLVFAATLALAHEGHDHGGMAGKGAAKPQLATTAAFDKAGRLWVTWAEG
QHVVVASSDDLGKTLSAPRRVNPQPEPIYTDGENRPKVIASPDGALYVSWSRPLDAPYTG
FVRFSRSLDGGRTWSAPVTVHHDRQPITHRFDSIAVDSAGHIFVTWIDKRDLLRAQAAKQ
PYDGAAVYYTVSTDRGATFAPERKVIDQTCECCRIALAPDADGHMLALWRNVFAGQIRDH
ALATLPIDNTPLAVTRATFSEWRVDACPHHGPALAVTADGVRHMAWFSVQQDKPGLFYSR
LSADGKPIGEPWGFAGSPQAGAQASHPALVAAYGALWLVWKQFADDRMQILLRKSIDGGA
HWSAPANVANTNGGSDHPQLLARDGHVYLSWRTQAEGYRLIDISNVVPSNSSLEASK

Enzyme Prediction     

No EC number prediction in MGYG000001384_02933.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.38e-09	51	231	24	218	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.39e-08	48	201	59	200	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.45e-07	49	246	154	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	2.11e-06	94	391	23	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
PHA03222	PHA03222	0.006	52	109	210	280	single-stranded binding protein UL29; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZU59242.1	1.08e-259	1	416	5	419
API78106.1	2.65e-259	1	416	1	415
ASL76887.1	2.65e-259	1	416	1	415
BCM05286.1	2.75e-259	1	416	2	416
AST89229.1	3.08e-259	1	416	5	419

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000336	0.998838	0.000282	0.000181	0.000173	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001384_02933.