CAZyme Information: MGYG000001384_04129

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_04129
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	MGYG000001384_3|CGC8	26460.39	8.8798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 1056350; End: 1057054 Strand: -

Full Sequence      

MMRWFGYVIGCFVAGVVALNLYFFAAIASWQVFDPSSTSFMRAERMRLCGANVFTCNVDR
RWVNYDQISRNLKRAVIASEDADFVSHSGWEVDAMLDAWEKNKRRGHVVAGGSTITQQLA
KNLFLSGERHYVRKGEELVITWMLEFWLDKERILEIYLNSVEWGEGVFGAEAAAQHYFKR
PASQLTVGQAVRLAAALPAPKCFDKKSYCANVHVNFTRKATVIANRMGSATLPD

Enzyme Prediction     

No EC number prediction in MGYG000001384_04129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	57	226	1.2e-58	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02070	mono_pep_trsgly	6.06e-125	6	233	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK00056	mtgA	2.50e-119	1	234	1	230	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
COG0744	MrcB	2.48e-78	1	230	17	243	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.56e-67	60	227	13	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.18e-47	59	227	1	165	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK36270.1	4.51e-173	1	234	1	234
AJW44398.1	3.99e-167	1	234	1	234
QIF08431.1	3.99e-167	1	234	1	234
ANJ73633.1	8.05e-167	1	234	1	234
ANA32929.1	1.14e-166	1	234	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.00e-30	55	204	14	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.57e-29	55	204	14	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.42e-24	63	204	42	183	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	9.74e-21	63	204	42	183	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3DWK_A	7.81e-20	63	204	30	171	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XVQ4	1.22e-162	1	234	1	234	Biosynthetic peptidoglycan transglycosylase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=mtgA PE=3 SV=1
Q46XB8	4.40e-135	2	234	20	252	Biosynthetic peptidoglycan transglycosylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=mtgA PE=3 SV=1
Q1LIV1	2.05e-131	2	234	1	233	Biosynthetic peptidoglycan transglycosylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=mtgA PE=3 SV=1
Q2SZD0	1.30e-90	3	233	28	253	Biosynthetic peptidoglycan transglycosylase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=mtgA PE=3 SV=1
Q63QP9	3.71e-90	3	233	28	253	Biosynthetic peptidoglycan transglycosylase OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000100	0.000006	0.000001	0.000000	0.000008

TMHMM  Annotations     

start	end
5	27