CAZyme Information: MGYG000001384_04789

Basic Information

• Species: Ralstonia pickettii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Ralstonia; Ralstonia pickettii
• CAZyme ID: MGYG000001384_04789
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183	MGYG000001384_6|CGC1	19696.47	9.4948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001384	5243975	Isolate	not provided	not provided

• Gene Location: Start: 34191; End: 34742 Strand: -

Full Sequence      

MKGSAFLLVMALLPALAFADCIDEAARFHQVDARLVRAIAQVESRMHADAVGANSDGSTD
IGLMQINSSWLPSLARYGITRAHLFDACVNAYVGSWILSRNIQQLGLTWDAVGAYNAKSP
AKRLAYARKVYQALATASSTPSRAIANPVASVRPVEAPRAAARRLQTNTSSDITIVSWEP
PNE

Enzyme Prediction     

No EC number prediction in MGYG000001384_04789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	32	139	7.7e-20	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.82e-58	29	134	1	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.43e-39	1	132	1	137	type III secretion system invasion protein IagB.
PRK13722	PRK13722	2.71e-24	20	132	21	140	lytic transglycosylase; Provisional
pfam01464	SLT	1.53e-16	22	117	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	3.18e-11	33	117	1	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK38257.1	3.26e-125	1	183	1	183
ANJ76619.1	1.09e-123	1	183	1	183
ANH77076.1	1.09e-123	1	183	1	183
APA88981.2	1.09e-54	19	150	11	141
AFT85983.1	5.08e-53	1	141	1	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.47e-09	20	103	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	1.61e-24	6	132	5	137	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	2.27e-24	6	132	5	137	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.27e-24	6	132	5	137	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P14499	2.24e-23	19	132	20	140	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P17738	2.24e-23	20	132	21	140	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.998956	0.000201	0.000178	0.000169	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001384_04789.