CAZyme Information: MGYG000001385_00547

Basic Information

• Species: Alistipes_A indistinctus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A indistinctus
• CAZyme ID: MGYG000001385_00547
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000001385_1|CGC10	69774.06	6.8027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001385	2850981	Isolate	not provided	not provided

• Gene Location: Start: 677074; End: 678966 Strand: +

Full Sequence      

MIRFKLILCCLLSGATLTVEAAPKRAPKAKPAPLPAAVQTQLEGRLGERMNACIRQRVMS
EDELSLVAPFKQRDEKELWQSEFWGKWTLGAVGSYRYNRDPELLAKITRGVQAILATQSP
DGYIGNYAPDAQLGGWDVWGRKYTMLGLLAYYDLTGDKKSLEGAVKLADHLLTQIPAQKS
IVRAGYYRGMPPSSVLVPMVMLYNRTMDSRYLDFAKYIVSEWETPDGPQLVSKALADVPV
AERFPSHGSAQAWWSWENGQKAYEMMSCYDGLLGLYALTRNADYLKAAEKSVRNIIDEEI
NIAGSGSADECFYHGRRMQTTPAYSMMETCVTMTWMQLCGHLLELTHDPLYADQIERTVY
NALLAALKGDGSQIAKYSPLEGVRSPGGPQCGMHVNCCNMNGPRAFAMIPELMATCAADT
LFVNLYGESVSKVPLAGGEVILRQQTNYPEQGSVELTVNPRKSREFAVAVRIPAWSKITM
VTVNGQAVADVRPGSYLTVSRTWKEGDKIALNFDMRGRLTELNGYQAIERGPVVLARDTR
LGEGFVDETCVVQTSGGYVELMPVTDKPAGVWMAFSAPMKLGTDTEGRAAGIVQVPLCDF
ASAGNTWHPAVRYRVWLRRTFDPISDPWVE

Enzyme Prediction     

No EC number prediction in MGYG000001385_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	77	535	4.2e-63	0.9026717557251909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.05e-74	77	536	49	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.84e-60	24	536	4	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	2.76e-04	95	215	99	227	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04791	LanC_SerThrkinase	0.002	146	216	93	169	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.006	145	293	416	565	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.80e-187	41	628	28	617
QHS51661.1	7.54e-45	86	538	123	582
QOY86860.1	5.01e-44	86	534	97	547
AXC10260.1	1.91e-41	86	538	133	600
AIQ46722.1	2.74e-40	67	534	59	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	7.05e-37	90	534	78	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.17e-33	86	534	81	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.28e-31	86	534	81	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.14e-29	80	534	90	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.91e-20	86	534	80	564	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.05e-19	86	534	80	564	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000408	0.998785	0.000209	0.000205	0.000182	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001385_00547.