CAZyme Information: MGYG000001385_00687

Basic Information

• Species: Alistipes_A indistinctus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A indistinctus
• CAZyme ID: MGYG000001385_00687
• CAZy Family: GH156
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558	MGYG000001385_1|CGC15	63105.72	5.9774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001385	2850981	Isolate	not provided	not provided

• Gene Location: Start: 868407; End: 870083 Strand: +

Full Sequence      

MKRDFASRLLFPLCGMLALTVTSCNKTAKDQPSRHRFIHNNDGSDALLNRWFGGHPAHKA
DIDRYVDMVAETSKGRTQVTTFMMCSGSDFIYYPSSKYGRYFGDDKNGTMPYADSATKKV
WQLGGQSVRNLEAEGTDVIKASLERAKMHGMEAFITYRVNDLHFADSSSGNPATFPDFWI
EHPEYWTGDSTQGWHSAQALDFSYPEVRQHKLNLIKEQLEKYDMIDGYELDFMRFIVLFK
SGEGKEKAPLITDMVREVKRTIDSLSEVRGHKILLAVRVPVTVEGALGKGLDVKQWAKEG
LIDFITIGVHWRGDTGIPVAKFRKDFGYDDIPLYASIDDGGYLPREFYSDGMYRGMASHI
LGQGADGVYLFNYYFGEISDRKIAGIPLLEEGGQVTRARTPELLNELGSLETLKGRNKIY
CMSDGVTDAYRALGIAPLPAAVSNGRETVLPLFIADDTQEIVPQEMILFLRTDRPAKFWL
EVNGIEVTEQKPEYVKLYNRDRGMRDGEQMYAFILPAGSIRKGDNMIRMVDKTLDNYFVV
QRVEVALKYGDVETNGYF

Enzyme Prediction     

No EC number prediction in MGYG000001385_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH156	28	552	4.7e-109	0.9365942028985508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1649	YddW	4.04e-05	124	318	102	315	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
cd14791	GH36	5.52e-05	177	276	95	196	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG53795.1	0.0	16	558	1	543
QGA27036.1	2.35e-200	15	558	16	557
QUT49878.1	1.30e-195	23	558	20	550
BBD44721.1	1.26e-188	61	558	3	491
PIW13520.1	1.63e-43	8	423	10	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZD_A	3.63e-44	40	529	12	485	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6RZD_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6S00_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S00_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S0E_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0E_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0F_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7],6S0F_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7]
6S04_A	1.12e-41	40	529	12	485	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7],6S04_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000048	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001385_00687.