CAZyme Information: MGYG000001386_00994

Basic Information

• Species: Enterocloster clostridioformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster clostridioformis
• CAZyme ID: MGYG000001386_00994
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000001386_1|CGC7	38819.39	7.8369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001386	5455983	Isolate	not provided	not provided

• Gene Location: Start: 988628; End: 989686 Strand: +

Full Sequence      

MTESDGQNGQEIRALRLTVAQDGSGDYDTVGAALAALGDKEGPPARIYIKKGVYRERLEI
KRPGITLEGQTAGGTVITCGLSAGMTMEDGSKRGTFRTYSVLVDAHDFTARNLTIENSAG
PGEAAGQALALYADGDRILFKGCRLLGGQDTLFTGPLPPKEIQKNGFIGPKQFSPRINGR
HCYRDCFIRGDIDFIFGSATAYFDRCELYSAGRDTERKGYVTAASTPRGQKYGYVFRNCR
FTGNSSRESVYLGRPWRDYARTVLIDCYLGPHICREGWHDWDKKDARSTLFYGEYGSYGP
GAAGREASEQGKRDRGTSRPDWVSMLTREQIQDYTMEQVLGGTDGWNPGHIL

Enzyme Prediction     

No EC number prediction in MGYG000001386_00994.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	339	9.2e-94	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.78e-84	19	342	87	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.09e-77	18	342	3	297	Pectinesterase.
PLN02301	PLN02301	5.97e-60	6	302	228	502	pectinesterase/pectinesterase inhibitor
PLN02708	PLN02708	4.17e-59	18	348	244	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	1.03e-58	13	344	9	290	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX89293.1	7.58e-272	1	352	1	352
ANU50094.1	9.92e-268	1	352	1	352
QQR01004.1	9.92e-268	1	352	1	352
QRP39805.1	6.22e-244	1	349	1	350
ASN95501.1	6.22e-244	1	349	1	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.27e-46	19	302	7	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.21e-41	17	303	9	274	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.66e-38	27	348	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	1.38e-37	8	339	27	357	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	3.53e-34	27	348	18	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.28e-46	19	306	9	274	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	2.06e-45	8	346	74	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q1JPL7	6.93e-45	17	302	247	511	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3
Q43062	7.96e-45	19	348	211	510	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O81320	5.06e-44	7	333	142	447	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001386_00994.