CAZyme Information: MGYG000001386_03388

Basic Information

• Species: Enterocloster clostridioformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster clostridioformis
• CAZyme ID: MGYG000001386_03388
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001386_4|CGC5	42866.77	4.8127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001386	5455983	Isolate	not provided	not provided

• Gene Location: Start: 319452; End: 320576 Strand: -

Full Sequence      

MRTADKKRVQEKLDLVIEKLMNLGGPENGEELSEGGEAIGFFKRDFGIREWDWPQGVGLY
GLLRIMQARKNEDYKEFLYQWFKDNMREGLPSKNINTTTPLLTLAELNEYYHDQEFEALC
FKWVDWLMNCLPRTMERGFQHVTSANGDRQGVRLNENEMWIDTIFMTVLFLNRMGQKYQN
QSWIDESIHQVLMHIKYLWDKETGLFYHGWTFNERNNFGGIFWCRGNSWFTLGILDYIDM
FKGTMNAGVKEFVVDTYKAQVEALKGLQGKSGLWHTVLTDGDSYEEVSGSAAITAGILKG
IRYGILDDSYLPCAWKAVEAILDSIDRDGTVLNVSGGTGMGYDADHYKNILIAPMAYGQS
LTILALAEALLHLD

Enzyme Prediction     

No EC number prediction in MGYG000001386_03388.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	369	4.9e-98	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.52e-86	50	359	33	339	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.80e-78	50	359	26	329	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX93991.1	2.07e-287	1	374	1	374
QQQ99851.1	1.62e-283	1	374	6	379
ANU45380.1	1.62e-283	1	374	6	379
QJU19354.1	1.95e-275	1	374	6	379
ASN96412.1	1.60e-274	1	374	6	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.90e-75	51	370	65	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.84e-71	51	370	66	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.66e-69	47	368	43	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	4.07e-19	51	368	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.71e-18	51	368	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.39e-49	42	370	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.23e-18	51	368	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001386_03388.