CAZyme Information: MGYG000001386_03554

Basic Information

• Species: Enterocloster clostridioformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster clostridioformis
• CAZyme ID: MGYG000001386_03554
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000001386_5|CGC3	54611.92	5.0262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001386	5455983	Isolate	not provided	not provided

• Gene Location: Start: 135414; End: 136850 Strand: -

Full Sequence      

MSVLKENFLWGGAVAANQCEGAWNVDGKGVSCADLCTGGSRTTSKRITRAVEEGTFHPSH
EAIDFYHHYKEDIALFAEMGFKCFRFSIAWTRIFPTGMEEEPNEAGLKFYDDVIEECLKH
AIEPLVTISHYEMPFAMTEKYNGWASRECVELFVKYAKVLFKRYKGKVKYWLTFNEINAG
TMPMGGYLSLGILNEGTTDFMNQKDIPALRFQGIHHQFVASALAVMAGHEIDPDCQIGCM
ICHITTYPLTCNPNDILKAQQKDQIMNQFCGDVQVRGEYPHFMKRYFEENQITVNMEPGD
AEILKQGCVDFYTFSYYMSNCESADKDKIRTGGNLTGGAQNPYLESSDWGWQIDPKGLRY
TLNELYGRYRIPLMVVENGLGAYDKIEEDGKIHDEYRIDYLKKHIEQMKEAVRDGVDLMG
YTPWGCIDLVSASTGEMAKRYGFIYVEKYDDGTGDLSRRKKDSFDWYKKVIESNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	475	1.2e-148	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	478	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	478	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	478	6	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	477	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	478	5	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX89735.1	0.0	1	478	1	478
QQR00635.1	0.0	1	478	1	478
ANU44609.1	0.0	1	478	1	478
SEU04537.1	2.41e-314	1	478	1	478
QFS30364.1	1.06e-289	5	478	4	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	2.29e-196	4	478	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	4.68e-191	6	478	10	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.31e-183	1	478	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.74e-183	1	478	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	2.16e-177	2	478	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.25e-195	4	478	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	4.46e-191	6	478	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	9.73e-188	1	478	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	9.92e-179	6	478	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.27e-169	1	478	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001386_03554.