CAZyme Information: MGYG000001387_01616

Basic Information

• Species: Senegalimassilia anaerobia
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Senegalimassilia; Senegalimassilia anaerobia
• CAZyme ID: MGYG000001387_01616
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	MGYG000001387_3|CGC3	90917.05	5.2344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001387	2354464	Isolate	not provided	not provided

• Gene Location: Start: 493838; End: 496249 Strand: -

Full Sequence      

MHISFGKICRGDGIAYIETIVHCSQQYAHTRFLARSEDGVPLPIESYRYQKAGTYVLATP
LLDTDKIIIESVVFDDKGNEIAKTKKSISRFMIKWLSRLNYRLDFKTVSALRDIDGYTYS
DQIHIRLTTFVESYEKQQYIIKGFVCAPVNASGLSLSLLDNKGCKVDAADIVFGRTSSTV
ALGLKRTEVDFTLRLSKECVSYCLVAAADNLSRSGFICFDQCSIDLFSDRYNPLFYRCTG
PVAYERSVESRKRFSRGLKPNDFVRTGNTAFSVVVPLFHTPLRFLNEMIQSVEDQIYTNW
ELLLVNATPEDQSLCAALEALQDSRIKVITLEGNLGIADNTNIGIEAATGDYIALFDHDD
VLDERVLYEYAKAIEANPQIDVLYCDEDFLTESGTYAAPHFKSDLNIDLLRCHNYITHLL
TVRSELAKSLKLRKEFDGAQDYDFVLRLAELTEQFHHVPDVLYHWRISDTSTAKDAGNKS
YATLAGQKALQQHLNRLGIRATACETDKPCFYRVEYAISGQPKVSIVIPNKDCAKVLTRC
VDSIEKKTTYSNFNIYIVENNSTESSTFDCYERLMSEYPNIKLLKWEKEFNYSAINNFGV
GQADGDYILFLNNDTEVIAGDWIDSMLSICQREDVGAVGAKLLYPDNTVQHAGVLMIACQ
SVNDVAGPIHVFNNIDADDPGYMRRAVLTQDVSVVTAACMMVEKRLFEELGGFDEYFAVA
FNDVDFCLRVRDTNRLVVFTPDAKLYHYESISRGYDSSGNNMRRFIEEQGKLRTRWSKYY
CSGDPYFGTASTSVFYVPSWCKI

Enzyme Prediction     

No EC number prediction in MGYG000001387_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	525	710	9.3e-22	0.9882352941176471
GT2	272	396	1.2e-21	0.7352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.78e-83	271	467	3	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.35e-43	526	749	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.71e-27	520	792	1	259	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.03e-20	272	472	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	2.11e-17	523	748	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB07226.1	1.27e-285	1	788	1	790
AZH69456.1	4.99e-207	1	786	16	806
ATP53720.1	1.60e-202	1	786	16	806
QOY61387.1	6.52e-186	1	787	1	793
ACV56006.1	6.60e-186	1	788	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.95e-07	524	614	7	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.15e-113	272	801	369	903	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.08e-95	272	757	322	802	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	5.47e-16	272	467	11	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q57287	8.04e-11	272	499	8	250	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
A0A0H2UR96	3.76e-10	272	384	6	121	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001387_01616.