CAZyme Information: MGYG000001388_00327

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_00327
• CAZy Family: CBM2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		34119.36	4.3832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 39917; End: 40858 Strand: -

Full Sequence      

MKRVILLLALILAMVSSITAGTLASYTVAIDNLAGGNVVAKEFIFVGEGTDTFQEGLKIA
PSETLQWQFKVKNYERHVVTETDMYYKLTFDVFASPGKKAIDPLTVTVKDGTGAILNQMT
GVGTFDLLGAFPLSETGQERNILVEIAWPDGGKSDKDYAGKEFGTSIIVNAQASQVPLDS
NPNPETPEGQVSVLYETTTPWQNGQSGEYQYQYKITITNNSSVSIEDWYITFLLQNDRLN
NAWNAKLISRSDEGIYRFENPAYNNVSMDNILPGQSVSFGGLASGMGTETLRNIGVGGSN
TSLITNVNVMHQP

Enzyme Prediction     

No EC number prediction in MGYG000001388_00327.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM2	192	295	6.5e-20	0.9207920792079208

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00553	CBM_2	8.91e-08	193	288	3	87	Cellulose binding domain. Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.
smart00637	CBD_II	2.85e-06	201	280	4	72	CBD_II domain.
smart01063	CBM49	1.15e-04	198	280	7	78	Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose.
pfam09478	CBM49	1.51e-04	206	280	14	76	Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE86270.1	7.69e-225	1	313	1	313
ACL18903.1	7.69e-225	1	313	1	313
CDX04743.1	4.45e-224	1	313	1	313
AFL99156.1	2.59e-194	1	313	1	316
AFQ44073.1	2.56e-132	1	312	1	313

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001677	0.997348	0.000279	0.000257	0.000210	0.000207

TMHMM  Annotations     

start	end
7	29