CAZyme Information: MGYG000001388_01101

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_01101
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	MGYG000001388_25|CGC2	48797.02	4.6591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 115688; End: 117055 Strand: -

Full Sequence      

MAINLALKKPTISSSYLQPYEPVRAVNGDYMTPMSRWLCTHLPGWLTVDLGEVYSFDRWV
VRQMPIAGWPSPDYCMSDFTLQGSNDAESWADLDNVAANTSAIVDRMLTAAASYRYVRIY
VTKGLNANDKFASLMEFEIYQAPPSLAGLIVKDNSDHTVELNPAFNSNTDSYQATVLLSV
ASVTLIPTVLDSSAVIKVNNTEVVSGTSSAPITINVGTNQIEVSVTVAGVTKIYTIEITK
AAAANPYLKAISITGNNKGAISLAQTFDPKNSFNYTALADYDDTNATVVLTADDPNAKLS
VNGGASSSGPITFPVTMSSLGDYSTAIVVEAADGTTTQSYSLKVTRPSSAYISSIDPIPA
VTFIKDPGPGTGFVRDYYNYKVVTSTPFRIKVFLEDYPNINKVSFQINSGSSTDLPHGNF
TSPILAPAVGSDLVTITVTSKTGEATKKYIIEVSK

Enzyme Prediction     

No EC number prediction in MGYG000001388_01101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	13	138	1.4e-20	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12733	Cadherin-like	5.08e-14	260	347	3	89	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
pfam00754	F5_F8_type_C	3.87e-12	13	137	5	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam12733	Cadherin-like	1.15e-10	161	241	6	89	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
cd00057	FA58C	1.67e-07	1	141	5	143	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE82323.1	0.0	1	455	1	455
ACL18554.1	4.91e-302	1	455	1	455
APM40081.1	3.71e-70	4	356	6	351
ABQ24964.1	1.61e-59	4	344	3	343
AKL96034.1	2.37e-58	4	347	10	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001388_01101.