CAZyme Information: MGYG000001388_01484

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_01484
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	MGYG000001388_29|CGC2	85238.13	7.2059

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 87676; End: 89907 Strand: +

Full Sequence      

MKAGNRIGENLLKQGYITEEQLNAVLKIQQEKGGMLGNILVESGFLSPQELTEYITASQF
SRLGERLIQAKIITPAQLKNAIAYQEQNGGRLGNILVLLGYLDSEQLDDFLHSNAKQKLP
LGQMLVQNGEITEEQLKEAISMQNKSGGKIGDILLFLRYVTPETLYRYLATQNNLGRVGN
QYNKQMAKKIPYEIALQFNAILINNRPDSYIVAVGDILPEESVQTIESYLDKPVEQVLAT
MVEIENLWETVYGNRLSEDSVFKLYEEQPENSAIVTFSKSQRIGLIVASIAFLIVLIANY
QVALFIGNILIQGLYAMMTILKLYIVYKGSYKDAQLHFAVEEVAAIDESQLPVYTILVPV
YKEKEVIRQLIHNIQVLDYPQYKLDVCILLEEDDKETIETVMNMNLPHYFTPVIVPPSQP
KTKPKACNYGLLRAKGRYVVIYDAEDRPEPDQLKKVYLAFKRLPDSYVCIQSKLNYFNSN
QNLLTRFFTQEYSMWFELLLVGIMKTKTPIPLGGTSNHFKIDFLREVGAWDPFNVTEDAD
LGIRLFKKGYHTAIVDSRTWEEANSKVSNWLRQRSRWIKGYMQTWLVHMRHPVELFRICG
LKGFIGYQAMVLGTPLLPLLNPIFWSLLVLWYLTEAGWISDLFPGILYYIACFQLIFGNF
MFMYTNAVGMYHVIRDCSLKNEQPFSYGLVKYALLTPLYWILMSVAAYKALIQLVIKPFY
WEKTTHGLTTVKYDTVNRSKLPT

Enzyme Prediction     

No EC number prediction in MGYG000001388_01484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	354	578	7.6e-26	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	3.14e-154	352	592	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	4.23e-48	292	719	1	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	2.40e-38	356	538	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06437	CESA_CaSu_A2	2.31e-25	352	580	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
pfam13641	Glyco_tranf_2_3	8.67e-23	352	580	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDX02487.1	0.0	1	743	1	743
AKA67429.1	0.0	5	732	9	736
AWI06117.1	0.0	5	732	9	736
AKN31735.1	0.0	5	732	7	734
AZV55411.1	0.0	5	741	6	742

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.79e-21	350	580	47	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q9LJP4	7.34e-11	331	599	178	442	Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
Q6L538	2.95e-10	352	607	230	484	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1
Q7PC69	4.08e-10	340	599	249	504	Probable xyloglucan glycosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC3 PE=2 SV=1
Q9FNI7	5.53e-10	346	597	91	338	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
283	305
309	326
610	632
642	664
685	707