CAZyme Information: MGYG000001388_03578

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_03578
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43132.06	7.6287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 71392; End: 72546 Strand: -

Full Sequence      

MKRFLTLNLIAVLVLSFSLVGCNTAQQQNTQAPNQIATESGEPPKAEAETRQDVLGEEKR
VVMGFYTDPEGEIPGSKESMMKNIKLMDEVSFFWYSFDANGKILTTGKKDLSIKEAAQKN
GAKAYALIHNMRGGLFDANLAHSVFANPQTRSKFINNIVQLVINEKWDGVAIDIEKTPPA
DRNNFTAFLGELHGALKAKDKVLNVSIPAKFIDYPSDLWSGAYDYASIGKNADQIVLMTY
DEHGLGTTHGPISSHAWVNKVISYAVTKIPREKIVLGLPVYSFDWGSNKPTMPDYLSYEQ
SMARAKKHGVEVGYDEEHKVPWYTYTANGVRHEVYFENKQSLQPKMEYAREHKLHGVAIW
RLGMEDPSIWDSLVKTYGTNKNKK

Enzyme Prediction     

No EC number prediction in MGYG000001388_03578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	95	365	3.5e-49	0.8108108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	1.40e-144	61	373	3	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.62e-71	90	373	131	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	6.22e-53	63	370	3	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	1.22e-34	133	364	71	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	3.95e-33	61	364	1	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE81922.1	1.12e-287	1	384	1	384
CDX00111.1	1.12e-287	1	384	1	384
ACL18141.1	1.12e-287	1	384	1	384
AGA67613.1	7.43e-277	1	384	1	384
AFL98556.1	3.80e-275	1	384	1	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	3.70e-47	90	366	36	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	4.13e-34	62	370	4	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4S3K_A	1.29e-33	63	370	110	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	2.90e-31	77	381	119	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	4.36e-26	66	373	10	335	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	6.98e-47	61	375	15	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	2.07e-45	90	362	128	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.11e-30	77	381	118	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	2.89e-30	77	381	118	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	1.34e-28	95	370	137	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001388_03578.