CAZyme Information: MGYG000001388_04479

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_04479
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000001388_60|CGC2	23327.8	7.997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 334949; End: 335548 Strand: -

Full Sequence      

MKKKGFTVRRKKKRSGFLFTLVLCVIAFTFLFSSPPIKKVIYPYPYKSLIEHYAEQYHVD
PLLVISVIRAESKFLPYSQSHKGALGLMQLMPDTADWIAETLGDGAFDQSELREPEKNIQ
YGTWYIASLQKEFQDIELVLAAYNGGRGHVNEWIRTEQLKVDDLNTEDIPFRETREYVQR
VMDNYEKYQDLYGEKPRLK

Enzyme Prediction     

No EC number prediction in MGYG000001388_04479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	58	189	1.5e-31	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.37e-78	43	187	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.77e-63	42	191	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.23e-41	61	186	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.34e-39	32	197	125	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.48e-33	53	155	4	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE83135.1	6.75e-144	1	199	1	199
ACL20501.1	6.75e-144	1	199	1	199
CDX01354.1	6.75e-144	1	199	1	199
AFM00344.1	2.47e-121	1	199	1	199
AGA69099.1	1.41e-85	1	193	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.73e-25	45	193	415	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.74e-25	45	193	419	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.76e-25	45	193	425	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.77e-25	45	193	429	574	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.79e-25	45	193	435	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.25e-17	42	198	476	635	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.25e-17	42	198	476	635	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31976	3.72e-17	46	187	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.72e-17	46	187	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P39434	2.68e-16	42	198	476	635	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000050	0.000002	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
16	33