CAZyme Information: MGYG000001388_04596

Basic Information

• Species: Desulfitobacterium hafniense
• Lineage: Bacteria; Firmicutes_B; Desulfitobacteriia; Desulfitobacteriales; Desulfitobacteriaceae; Desulfitobacterium; Desulfitobacterium hafniense
• CAZyme ID: MGYG000001388_04596
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001388_60|CGC5	31371.37	4.4755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001388	5194328	Isolate	not provided	not provided

• Gene Location: Start: 457183; End: 458043 Strand: -

Full Sequence      

MPHRRCRKTTAIFLCLVMTLFWCQGMVCPVNGELGTNTFEIVDIEVLDAVQIVDLQAMGV
NRGEAENRLRETDNSPAMEETVTEQEEAALSDELAVPEDEQMIVVQSGDTLSAVAHRYGT
TIAELMKLNTINEPNTIGAGQTLRIPAKGETIADSAAEPSRGRAPVIQVTQEELELLARV
IHAEARGEDFEGQVAVGAVVLNRVEDQRFPNTIHDVVYQPGAFTAVLDKQIHLTPNQSAY
RAAEAALNGEDPTGGAIYYYNPRTATDRWIKTRPVVKTIGNHTFSI

Enzyme Prediction     

No EC number prediction in MGYG000001388_04596.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07486	Hydrolase_2	6.57e-54	187	284	1	100	Cell Wall Hydrolase. These enzymes have been implicated in cell wall hydrolysis, most extensively in Bacillus subtilis. For instance Bacillus subtilis steB is expressed during sporulation as an inactive form and then deposited on the cell outer cortex. During germination the the enzyme is activated and hydrolyzes the cortex. A similar role is carried out by the partially redundant Bacillus subtilis CwlJ. It is not clear whether these enzymes are amidases or peptidases.
COG3773	CwlJ	3.75e-40	165	285	110	241	Cell wall hydrolase CwlJ, involved in spore germination [Cell cycle control, cell division, chromosome partitioning, Cell wall/membrane/envelope biogenesis].
cd00118	LysM	8.40e-14	104	145	4	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.39e-12	103	146	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	3.61e-12	103	145	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE85046.1	5.10e-205	1	286	1	286
CDX03393.1	5.10e-205	1	286	1	286
AFM02072.1	9.37e-156	1	286	1	299
AGA70537.1	3.95e-110	1	286	1	300
AFQ46106.1	1.85e-52	154	286	197	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F55_A	5.56e-41	170	284	12	126	CrystalStructure of the Catalytic Domain of the Bacillus cereus SleB Protein [Bacillus cereus ATCC 14579]
4FET_A	4.82e-39	149	284	85	220	Catalyticdomain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis],4FET_B Catalytic domain of germination-specific lytic tansglycosylase SleB from Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3V0	2.12e-40	119	284	92	257	Spore cortex-lytic enzyme OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=sleB PE=1 SV=1
P0A3V1	2.12e-40	119	284	92	257	Spore cortex-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleB PE=1 SV=1
P59105	1.24e-35	162	284	148	274	Spore cortex-lytic enzyme OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=sleB PE=3 SV=1
Q9KCE0	5.76e-35	173	284	217	328	Spore cortex-lytic enzyme OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=sleB PE=3 SV=1
O31685	1.08e-32	170	286	92	208	Uncharacterized protein YkvT OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005217	0.965343	0.028714	0.000249	0.000224	0.000231

TMHMM  Annotations     

start	end
12	34