CAZyme Information: MGYG000001389_01431

Basic Information

• Species: Cloacibacillus evryensis
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; Cloacibacillus; Cloacibacillus evryensis
• CAZyme ID: MGYG000001389_01431
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		72035.77	4.9635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001389	3281561	Isolate	not provided	not provided

• Gene Location: Start: 258934; End: 260850 Strand: +

Full Sequence      

MQNEIIYGPTLAGEEDVYLFREGTHRRIYDFLGAHPLEHEGRPGVLFALWAPGAKDVYVM
GDFNSWDREGCPLSPRWDSSGIWEGFVPDAAPGHRYKYLIRTAGGGMLEKSDPLAFGTEL
PPASASVVCDPAHEWLDAEWMAKRAGRNAVDAPQSIYEMHAGSWRRGDGDGILSWRDLAG
ELPPYLEANGFTHVEFMPVMEHPFYGSWGYQTTGYFAPTSRYGSPEDFMALVDALHARGI
GVILDWVPSHFPTDSYGLSRFDGTALYEHEDPRQGFHPDWKSAIFNYGRNEVRSFLISSA
HYWLDRYHADGLRVDAVASMLYLDYSRRGGEWIPNKYGGKENIEAIAFLREMNGALYADF
PGISVTAEESTSWPMVTKPVWLGGLGFGYKWNMGWMNDFISYMSQDPVYRKYRHDQLTFG
MWYAYSENFVLPFSHDEVVYGKCSLLEKMPGDGWQKAANLRLMFGWMFGHPGKKLVFMGG
EFGQSREWNHDRSLDWHELGDPRHAGIARWFADVNNFYRSRPELWELDSSPDGFEWIDCS
DRDAGVVSFIRRDREGRSVVFAANFTPVVRYGYRVGLPAGGRWDEALNSDAEIYGGSGVG
NMGGVEAEEVPFHGQDFSAALTLPPLGIIILRAPALCL

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	184	484	1.8e-157	0.9966777408637874
CBM48	32	116	6e-17	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	10	632	5	626	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	31	631	26	619	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	7	627	599	1216	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	9	633	3	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	7	635	96	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ46564.1	0.0	1	630	1	630
QJT09347.1	7.77e-310	1	632	1	635
ALC15342.1	1.59e-307	2	634	3	638
ACI20861.1	1.65e-306	7	632	4	631
BAV33692.1	1.20e-305	8	636	20	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JOY_A	1.13e-258	14	632	6	617	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
1M7X_A	1.90e-246	19	629	1	610	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
3K1D_A	3.64e-245	9	629	99	717	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
4LPC_A	1.05e-244	24	629	1	605	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.58e-238	4	632	116	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66936	3.30e-296	10	632	5	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q5NXV7	3.76e-287	14	631	12	625	1,4-alpha-glucan branching enzyme GlgB OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=glgB PE=3 SV=1
Q1AZ86	2.06e-281	9	632	96	718	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q21WG7	4.26e-281	11	630	1	618	1,4-alpha-glucan branching enzyme GlgB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=glgB PE=3 SV=1
A3PIQ5	7.43e-271	9	629	107	723	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) OX=349101 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001389_01431.