CAZyme Information: MGYG000001391_00284

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_00284
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1402		153451.5	4.7742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 274754; End: 278962 Strand: -

Full Sequence      

MTMNKHLLLIILLFITWITPVKAEDLKLWYDRPADYWVEALPLGNGRLAAMVYGTILQDT
IQINEDTYWSGSPYNNANPNAKTHLNQIREYINDGEYAEAQKIALANIIADRNITGHGMI
YESIGNLLLDFPESHKTPTNYYRELDLSNAIAKVTYTVDGVDYTREAFTSFTDDLIIIKI
SASKQGMVNFNTSFVGPLKSNRVKASTEIVSGTNNTIRVKNTPGKTAEENIPNLLRPTTY
IRVVAEGGTQSADSSNKILKVSDADVAYIYISSATNFINYKDISGDSDAKALSYLNKFDK
DYEQAKNDHITRYQEQFGRVSLDLGNNSVQEKKPTDKRIEEFSNTNDPSLASLYFQFGRY
LLISSSQPGSQPANLQGIWNPNAGQYPAWDSKYTTNINVEMNYWPAEVTNLSECHQPFLE
MVKDVSVTGQESAETMYGCRGWTLHHNTDLWRSTGAVDKSACGIWPTCNAWFCSHLWEHY
LFTGDKEFLSEVYPILKSACEFYQDFLITDPKTGYKVVSPSNSPENHPGLFSYVDDSGNK
QNVALFSGVTMDNQMVFDLLKNTIDAAEILGKDADFAADLKKLKDQLPPMHVGKYGQLQE
WLEDWDKETSGHRHVSHLWGMFPGNQISPYTNPQLFQAAKKSLEGRGDASRGWSMGWKVC
LWARLLDGNHAYKLIQNQLKLKDPNATIDDPDGGTYANMFDAHPPFQIDGNFGCCAGIAE
MLLQSHDGTVHLLPALPDAWSEGNVKGLKARGGFEIVDMQWKWGEIVSVTIKSSIGGNLR
IRTATPLKANGNFTLSVATGNNSNPLNSVYEIPDPIIKDESKIPELVLQETTVYDLQTEA
GQSYTLVPVSNIYEWTGSSSSTWNEANNWNPVGVPGDKDLGIVNSGEIDINGNSFAGSIS
IHENSIVNISKTSELKGNLSFEGGSVKNDQNGVIFTAGSASIENNTNFQITGTLILATSI
SGEGSIDKKGSGTLTIQGDNSNFSGDLNINDGELAVSGMNAAGTGNIKIENSAKLTVKSD
DCLFHKTKIEVAEGGKINLSANISLSEVYTNNNLLAEGKYTASSLPAYLEGNGTLTITHP
QYPFIWTPKDNKKWNVAANYTPAILPTEGDTVIVESEIEAETASFPVIIYLNSANIRLRK
DTEIKELYMAGGTKLNYATSGSGFSLNAPIHINGEINLQLSGGEINAMTFPGNIDGKSTV
TIDNSSNSITEASIVLKGNNSEFSGIWNITNSPRTEGSSISISGEGANAFGASEIQVGAG
NKVIFKHANAAGESTTLSLLSGGKAVMNTNGIVGKLILNDTEYTEGTFDANSHSEFFEGN
GTLTVKGNTSGIKEETVQNGNQANYRNGILSLQYPCENLCISDMQGRILLDKIYGQQFSI
KLNNGIYLIKADSQIIKLIVKE

Enzyme Prediction     

No EC number prediction in MGYG000001391_00284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	22	784	4e-289	0.9847645429362881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	3.37e-73	28	277	1	231	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
PRK15319	PRK15319	1.14e-09	866	1045	908	1080	fibronectin-binding autotransporter adhesin ShdA.
PRK15319	PRK15319	3.88e-07	876	1017	791	927	fibronectin-binding autotransporter adhesin ShdA.
PRK15319	PRK15319	8.22e-07	839	1072	600	855	fibronectin-binding autotransporter adhesin ShdA.
TIGR02601	autotrns_rpt	5.53e-04	968	997	4	32	autotransporter-associated beta strand repeat. This model represent a core 32-residue region of a class of bacterial protein repeat found in one to 30 copies per protein. Most proteins with a copy of this repeat have domains associated with membrane autotransporters (pfam03797, TIGR01414). The repeats occur with a periodicity of 60 to 100 residues. A pattern of sequence conservation is that every second residue is well-conserved across most of the domain. pfam05594 is based on a longer, much more poorly conserved multiple sequence alignment and hits some of the same proteins as this model with some overlap between the hit regions of the two models. It describes these repeats as likely to have a beta-helical structure. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73981.1	0.0	3	1402	1	1400
QCP72031.1	0.0	5	846	2	843
QCD38342.1	0.0	5	846	2	843
AWK06253.1	0.0	3	845	5	843
APA00322.1	0.0	24	844	21	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	1.11e-267	3	844	1	802	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	2.03e-189	16	784	30	760	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	1.71e-179	25	774	2	745	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	4.69e-98	23	782	15	850	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.64e-97	23	782	15	850	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	6.46e-155	23	767	49	798	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	3.33e-89	23	767	18	762	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	1.45e-73	43	782	46	797	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.01e-58	27	781	17	714	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000191	0.999223	0.000158	0.000151	0.000143	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_00284.