CAZyme Information: MGYG000001391_00334

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_00334
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000001391_1|CGC3	43562.43	8.3968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 359039; End: 360151 Strand: +

Full Sequence      

MRLRYVCLLFCIFFVGYMKAGNTKISPDSLMSVMKRVADWQIADYPRHLHKWTHTPVMWT
NGVMYIGMAEWASLWKDDSYFEWLKKIAAKERWHPAKGMYFADDICVSQLYCQLYEKYKD
PVMLQPTEARLEWVMNHPSKAKLTYEAPHSHDRWCWCDALFMAPTVYARMGKITGDIRYW
NFMEKEFWETVELLYDRKENLFYRDTRYLSMREKNGAPVFWGRGNGWVAGALAVIIDQLP
ENYPTRLKYITLYQQLMKRVAGLQDDEGYWHASMLDTETYRMPETSSTAFFVYGLAWGIR
RGYLPEKKYFPIMEKGWSALVRAVHPDGKLGWVQAIGSDPQRVSADMTEVYGTGAFLLAG
TEIYRMLMEK

Enzyme Prediction     

No EC number prediction in MGYG000001391_00334.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	365	8e-89	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.59e-94	33	367	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.38e-58	59	367	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD20872.1	9.24e-134	13	367	232	588
QUT48952.1	6.76e-132	20	366	90	438
QDO68587.1	1.15e-131	28	367	243	587
QUT88594.1	1.74e-130	31	367	246	587
ALJ60399.1	2.47e-130	31	367	246	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.79e-77	28	366	27	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.28e-55	20	367	20	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.51e-47	19	367	6	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	8.58e-19	156	367	200	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	2.05e-16	136	306	108	285	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.10e-83	28	363	51	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.20e-76	28	366	34	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.31e-73	56	366	55	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998973	0.000226	0.000157	0.000165	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_00334.