CAZyme Information: MGYG000001391_00899

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_00899
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000001391_2|CGC1	76359.71	7.4525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 11718; End: 13712 Strand: -

Full Sequence      

MRKMLLTVSLVFIAFISASQLRANNEANTLTEGVNNRSCEKTYRFFTDEDLRNVEASAKT
EWGTKIVGMLKERVDERVRYGFDIPDKSTGRSQNYICPVHKKLFKFELDKPHDHYCPDCG
KSYKSDFFDACWRNIYQHNMQYFIVDCGYLYLATKDKKYFDYLKEIFLEYADKYPQYPVY
TKEQVAKSYYLGRMFEQWLEDAMWFSDVCPIYEIIRDGLTQQEREKIEKNLFQEAADMIT
ARRGQHNWQAWNNAMRTSLAVTLKNDEMMDYAVNGSVGYIEEFKKMVYDDGWYKEASPGY
HYFPLKALLQTANAARACGIDLYNEKLKSMLTGVVKAMYPNMTFPAHNDGGYMSDISNQD
FLYEMGYSRFKDPFILQILAKVYATKDRNSALALLTNVDIKPDKTPLKQDSYLFDDTGIS
ILRSGDNTLVFRYGFSDGGHSHPDRLSVTLHNGEKEILTDCGTYSYAQPAYLGWQKRGLS
HNLVLVDGQDMQIRGVKSAGRLLSFDPDKNGGVASAVLDNNGYPGVKLTRTVKLDRNKFI
DRFEAQSEEEHTYDYVLALSDKPELGDGFVDTRLEGKSPAYEFIKGVKSKIYKNGIVTFK
AGTTKFEIKNTYKTPIEVFWAEAPDIMYGSSEKDTHTIKSYMLVVRTKGKNLSISSDIIL
SKKR

Enzyme Prediction     

No EC number prediction in MGYG000001391_00899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	418	539	1.7e-18	0.9420289855072463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	3.01e-18	410	554	5	159	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16889	Hepar_II_III_N	1.09e-07	281	350	243	317	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam05426	Alginate_lyase	2.30e-07	151	326	68	250	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00244	AlgLyase	0.002	221	325	148	259	Alginate Lyase A1-III; enzymatically depolymerizes alginate, a complex copolymer of beta-D-mannuronate and alpha-L-guluronate, by cleaving the beta-(1,4) glycosidic bond.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD20870.1	1.53e-152	40	657	20	633
QDO68586.1	1.29e-138	38	657	17	633
QUT88595.1	2.25e-136	38	657	17	633
ALJ60398.1	2.25e-136	38	657	17	633
QDO69002.1	2.10e-127	43	657	598	1213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NEI_A	9.91e-24	137	557	88	549	Alg17cPL17 Family Alginate Lyase [Saccharophagus degradans 2-40],4NEI_B Alg17c PL17 Family Alginate Lyase [Saccharophagus degradans 2-40]
4OK4_A	9.91e-24	137	557	88	549	CrystalStructure of Alg17c Mutant H202L [Saccharophagus degradans 2-40],4OK4_B Crystal Structure of Alg17c Mutant H202L [Saccharophagus degradans 2-40]
4OJZ_A	1.74e-23	137	557	88	549	CrystalStructure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OJZ_B Crystal Structure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OK2_A Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40],4OK2_B Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FSW8	2.05e-26	137	557	95	554	Alginate lyase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt2602 PE=1 SV=1
Q21FJ0	5.43e-23	137	557	88	549	Exo-oligoalginate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=alg17C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001391	0.997424	0.000296	0.000316	0.000281	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_00899.