CAZyme Information: MGYG000001391_02116

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_02116
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000001391_4|CGC1	74079.91	8.2891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 29431; End: 31344 Strand: -

Full Sequence      

MKKFLKYYLLISAVCFWHIDSHAETKDLSPQQHYEQMQRKLATGWNTWDTRSALTHVLLP
YGAAIDLHVIDGKGIRKNSFTIGSGLLHAGPHTYDGKYTDISLRWNDQKLRIESSADSLE
NIIRITPLEGNNPEGKIIVVLKGVWQRDVKIQVNGQQFQFRPGNLKQEIKGQAYGKWIKS
ERNEITFSTQEPVTICCGSDIEPVKAQNKLRESADRFVNNNKKQYGDDYEVYNAMQNVLS
WDNIYDPTIRKVITPVSRDWNINWSSNPNYGGFVLFCWDSYFAAMMFSAGNRELAYANAV
EITKSITESGFVPNFYSGNDYKSRDRSQPPVGSLAVWSLYKKYGDKWLLELLYPDLIRWN
RWWDKNRNIDGLLCWGSSPYPRVTYRNHEYGSVNNHYGGCLESGLDNSHMFDNVPFDTER
HMLLQNDVGLSSLYIMDCKLLALIAQELGYKKDVKELRKRAKQYSIELQKLWDEEEGLYY
NRRTDTRKKNPRISPTNFYPMLANIPSQTQAERMVKEHLMNPQEFWGEWVIPATPRNDPA
FKDNDYWRGRIWAPLNFLVYMGLQNYDLPEVRKAVAQKSKALLLKEWLKDGSVYENYDSV
LGEGPHRRSDRFYHWGALLSYIALIEDGYIAPIKIND

Enzyme Prediction     

No EC number prediction in MGYG000001391_02116.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	400	599	4.9e-19	0.395112016293279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	9.53e-18	310	603	391	762	alpha-glucosidase; Provisional
pfam01204	Trehalase	6.60e-16	278	598	131	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.19e-15	349	622	188	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	2.27e-13	275	607	172	527	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	6.07e-07	265	570	274	555	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH81205.1	5.43e-269	10	629	1	635
QDO68990.1	1.32e-264	1	631	1	633
QRQ47302.1	1.34e-259	8	630	5	632
QUT46474.1	1.91e-259	8	630	5	632
QNK58860.1	1.44e-172	34	629	18	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.37e-11	270	602	315	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.85e-11	310	602	364	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.76e-10	270	602	315	734	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
2JF4_A	4.21e-10	275	604	126	476	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
2JG0_A	7.34e-10	275	604	126	476	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.87e-10	270	602	338	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
O42783	3.16e-10	459	629	525	697	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
P52494	3.48e-10	471	629	704	863	Cytosolic neutral trehalase OS=Candida albicans OX=5476 GN=NTC1 PE=1 SV=1
Q1RCP3	1.05e-09	234	604	129	506	Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=treA PE=3 SV=1
B7MK99	1.05e-09	234	604	129	506	Periplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000591	0.997820	0.000938	0.000218	0.000218	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_02116.