CAZyme Information: MGYG000001391_02176

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_02176
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975		110899.31	6.6309

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 116117; End: 119044 Strand: +

Full Sequence      

MRKICQIFFMLLFVLFIGQMRAQQTVNIGETPWKFSKVIRQESNLVSGLTVLSGTDVVSG
INDGKFDTGAGKPLVGKNYFVDLLEKKPIERIKLVFNGDSVRYVACRVEVSDDNNNWRIL
SDGLSAQECELHKENIFTEAINNTIGNVAVVTRTLFSVPVSGSYRYVRFTVTECLSSDRK
DLSAEIGELLVHPVSRNIWSENELTGIAFDDSEWETVGLPHCFNERDTYLNATTGERCWR
GEAWYRKKIFFKEKDRDKKIFLEFKSVNIGAIVYVNGHAIRGDFKAKQPGPVTHVGSFMP
FVVDITDYIKWNEENQIAVRVSNSKGTFFAWPGFGENEGFGQAMGGIAASVYLHKKNKVH
IPYNSYTPLKKWGTYFGTVSANPQKAVMRFQTNVENATDEEQSVELRTKLIDKKGRTVLS
FSDVEEIAPGQTRLFDRTGSVENPHLWYPVGCSGEPYLYTVSNQVYVNGKLTDTKNERCG
IREITWDEDYCYVNGEKCILRGFGNRNTYPGLGSAVPVSLQWQDIAYIAKCGGNAYRVGH
QPPFAEIFEACDVYGVLVILNTGDNEWALRDEPSLSYKWECDRDVMIAYRSHPSVAVWES
NNGLPYEGEKYYPSYTLEQVRRWDYIQPRIVSNRDGFPPKWNKEDPILIGYTNRYEKMKG
YPSYNSEVYGTNWSGNPSWCIARFDYDNEKRFSQYYVENYLQDLDNKACGWIDWMLAETY
GEGYTIYLNGKRNQKSLGSCAMDGNRFPKLKYRIYQNALWIPYSQKPGVALQSHWNYSGI
QDVDAWSNCPYVELFINDKSYGIVEPDSRTRRCTWKDIQWVPGVVKAVGLDADKKPVCSE
KIESSGEPYAIEVTIEKPMPKPDGEQFVLRANASDAFIVTAKIVDKEGRWCPRADNLLNF
EVEGEGVYKGSYNFYVTENKELSYHAPGDAELQAEGGLMRVAVRTTFNPGKIKVKVKSEG
LVAGEASIRSKKVKM

Enzyme Prediction     

No EC number prediction in MGYG000001391_02176.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	208	722	7.3e-67	0.5558510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.13e-32	172	623	5	419	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.04e-28	241	598	65	412	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.14e-20	245	602	113	448	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	2.27e-18	868	967	9	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam00703	Glyco_hydro_2	2.74e-13	381	482	13	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74086.1	0.0	14	975	13	975
ALK28947.1	1.70e-145	208	967	66	861
AJK44668.1	1.82e-145	208	967	91	886
BCF94458.1	1.07e-144	208	967	46	831
AXF04603.1	4.53e-144	208	967	66	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	6.73e-84	207	970	57	804	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	1.74e-59	207	968	47	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.25e-49	208	968	33	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	1.80e-48	208	968	27	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
6ED1_A	4.93e-47	200	805	39	650	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	3.24e-83	207	970	48	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	5.16e-56	208	961	65	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	1.78e-45	202	971	20	737	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.63e-37	207	920	72	793	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	9.55e-27	210	910	26	706	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999127	0.000197	0.000145	0.000144	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_02176.