CAZyme Information: MGYG000001391_02182

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_02182
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1397		156896.36	4.6032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 128919; End: 133112 Strand: +

Full Sequence      

MKQNSFRTSLFILLCFLLFSGTISQAAEWEMKKGPMMTKWSETIDPNNVLPEYPRPQMVR
SDWMNLNGVWDLRKGVIDEAYSADFDYDKKILVPFPLESAISGVMEKSDEQCYWYRRTVV
IPESMKGKNILLHFGAVDWKTVVYVNGTQVGTHTGGYDPFYFDITSALKGSGEQEIAVYI
YDNTGMEGQPTGKQSRNPSICWYTAVSGIWQTVWLEPVNPVHIASFTMEPNLDKKWLSLM
VNPSEPEGVTVNAKIKDKEGNVVSTLENGNPAGIIRMTIDGEVHPWSVEDPYLYDLEISL
LKNGKETDAVKSYCGIRKIEVKKVGDIPRIFLNDKQIFQMGPLDQGWWPDGLYTAPSDEA
LLFDIRTMKELGFNMVRKHIKTEPARWYYHCDKEGILVWQDLPSPNLPKGHEDFAKANFE
SESKSIIDALKNHPSIVQWIVFNEGWGQFDTERMTNVVDSKVNSLNPARFGKTTLICCAS
GWTDAEVGNIIDTHSYPDPSCPSNANRAAVCGEYGGITLKVPGHIWPGGDFQYTTVETGR
DFTAFFNGLCDKIKDFYYQGLNAAVYTQISDVEIEKNGILTYDRRVLKPYSPYGELKAKI
EECVNMPQNKVIIKPILSTAKDHKYTWRYNTTTDVPRRWFAKEFDDRAWAKGVAAFGAGL
PEHSADLVSTEWKTSQIYMRRWFYLGDITPEMIDKLRFVLFHDDDIEIYINGVWAATRTG
CVFNYVPKDISEEAKNALKPNSWNLIAVGGKQGGGQQIMDVGISAFVTEDFEYTENYDEL
ENPEYSDIPTPGIVITPRFEKILQPVPAEPAQSGNGNETAVGEFYHTSDRSNVAWGDFDN
DGKLELVYSGNNDHLSSSKQGAALLYKYAGNDEFERKDSPFDICYYACPVWFDYNNDGLL
DLFVPGLKNKDYENDLNDVAAFLYENKGKGSDGNYVFEEVNVADKSGNRMGIYPIYNDTD
GGRSRQWVSVGDYDKDGYLDIVVTGRDDYEDADGMLAEDGNVLVHHDRRAVYLYKNDKGK
RFIRQETPLNGTDPFLGLARGSVYFADMDNDGWLDIVSSGYGPNEGNLHVYWNNGDGTFS
ETGQHFYGSYDSSCALGDLNADGYMDIVVTGYSRNKGGGSAKSFFVYKNCGNRSFEMLND
AFCGFEGVDGATPSLGDVNHDGLPDILVGGHGAEHEITTWLYLNKGDFYFESYGAYYDDP
FGKLGSFDRISHGNNHLVDYDNDGYLDAWNMGWAQASVCSKACATQLWKNSSGSKDIDSN
AAPSAPKNLRYSYDKNTRMATFTWDAATDDITPAPALQYNLYLRKAGSSEYFMTVPADPA
TGFIKVAEISGQIMTTSYSMYVPDENVDYEWGVQAIDNGKRGGKFAKADFNPTTTGLKKK
RFQTLTSMFPTEKSVIM

Enzyme Prediction     

No EC number prediction in MGYG000001391_02182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	56	458	5.1e-105	0.4734042553191489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.64e-42	54	444	6	406	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.81e-33	65	444	14	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.39e-24	61	444	39	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam13517	VCBS	2.56e-13	1047	1109	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam02837	Glyco_hydro_2_N	8.21e-12	114	215	68	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74091.1	0.0	16	1376	11	1357
ARN55733.1	1.46e-215	25	768	21	742
QUT74822.1	8.29e-212	3	779	431	1207
AQQ08666.1	1.05e-211	25	772	21	745
QEM14171.1	2.90e-207	23	765	17	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.02e-146	27	588	3	569	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	2.67e-31	40	461	16	445	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
3FN9_A	4.65e-30	114	470	63	427	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7CWD_A	9.89e-27	114	444	67	404	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
6ED1_A	7.64e-26	114	446	80	423	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	8.06e-30	114	466	106	454	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.85e-29	62	467	4	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q9K9C6	1.27e-25	121	446	130	462	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
T2KM09	1.98e-24	114	444	109	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P23989	2.58e-24	22	470	33	483	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000338	0.998945	0.000188	0.000177	0.000158	0.000146

TMHMM  Annotations     

start	end
7	29