CAZyme Information: MGYG000001391_02456

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_02456
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	MGYG000001391_5|CGC1	102960.81	4.5917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 14169; End: 16946 Strand: -

Full Sequence      

MKRLLVILIMCYGVLGGISAQISGVHFPKMKPVQTPVFVSVGGATESPEALHICRIFQGI
INRDSAEVFLSTGDKELDWFKYLDVKYKRPDQGVIVTGENRGLRTLFKSYKDRLDKLVIC
NFSDNDYTFNMALLMACAEDALPVSEELKDELVAEFGWDKEIVDIRNNWSTITQAYNWAL
EEIMPKLNKQLVFSIGLRDDWRNGGWRIYDYAVASRSFAFWVDDETTTGKNIIKKILNTP
GYPKNAVVMGYGMHGDDLNLTTNPEGFGFVVSDLFPNASYYSSFPSETFEERQPEGVAVD
AETNKVYVALHWSDGDNIQFNHNGTLDIWKQSERGKVPVSMTLSPALTEIAPFILQYYYE
NRTDNDEFIGGPSGVQYIQEPYYKPDDYELWCVMNGQYLKAAGMFSTASSLRWPAQPFYN
NGFVKTGVTGTLAWTNGAYKDAYNWCGMPVVGTGGVCSDEDGIYNYLKGVAARNDIPVFT
GVYMVQAGLGGAGYAAINRVVERLQSEFPGKYVFLKASDLLATAKKYFTERQKPYKDLAI
PGRIEAEDFDLGGQGAGFYDMATSNEGGAYRNEEGDYVGVGVGGSGYHIGWTTTGEWLNY
TVNVEKTATYKMTVRYSTPSGQDKGICVMLDDEVLSSMELKSTSGVDNYADYMVRVTIPE
GTHNLRVQITNGGMNLDYYDFEEDTETIPVIERSKGYKIIAVHSGKALALKTNNTTNGTK
IIQKEYTGDNTEIWRLNVAGDACYGLQNVASGLNIVLRGTNTIGQFPFDCTVNNGKWNLY
YQGDGCFTIVQKGALKYLEISDSSMNEGAELSVGDLTGEDNQKFRIEEAADYTGVDHSII
SENSVGVAYPNPFVNEIYIPVSIKQSQDIEIALFDLAGRCVYRNMIFLNDGDRELVVSGN
NLPSGIYVWRLNGESVHSYGRVVKK

Enzyme Prediction     

No EC number prediction in MGYG000001391_02456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	546	682	2e-25	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16216	GxGYxYP_N	1.60e-60	58	281	5	215	GxGYxY sequence motif in domain of unknown function N-terminal. This domain is found in bacteria, archaea and eukaryotes, and is typically between 213 and 231 amino acids in length. This domain is found in association with pfam14323.
cd04080	CBM6_cellulase-like	5.08e-41	540	682	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam14323	GxGYxYP_C	2.76e-30	304	484	1	200	GxGYxYP putative glycoside hydrolase C-terminal domain. This family carries a characteristic sequence motif, GxGYxYP, and is a putative glycoside hydrolase. This domain is found in association with pfam16216. Associated families are sugar-processing domains.
smart00606	CBD_IV	4.44e-14	539	681	3	129	Cellulose Binding Domain Type IV.
cd04079	CBM6_agarase-like	1.68e-11	543	668	5	116	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77716.1	0.0	27	925	27	914
ANH82740.1	5.74e-29	56	377	74	380
BCJ99038.1	8.49e-27	38	404	180	536
ACL15778.1	2.37e-26	450	689	160	390
AXT61911.1	2.01e-25	529	740	236	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G56_A	5.10e-24	543	808	340	598	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
3SGG_A	5.78e-18	67	404	79	400	Crystalstructure of a putative hydrolase (BT_2193) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution [Bacteroides thetaiotaomicron]
2Y8K_A	6.18e-18	543	680	342	479	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5LA0_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20],5LA1_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20]
5LA2_A	6.18e-18	543	680	342	479	ChainA, Carbohydrate binding family 6 [Acetivibrio thermocellus],5LA2_B Chain B, Carbohydrate binding family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000414	0.998898	0.000185	0.000165	0.000157	0.000150

TMHMM  Annotations     

start	end
5	27