CAZyme Information: MGYG000001391_02949

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_02949
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		74779.21	9.0105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 5693; End: 7657 Strand: +

Full Sequence      

MILKKISFLLFIFFIGYLSLHADNFPQKSIDGKGFYLYKVNRAEGFYSICKKFDVSKEEI
IQFNPSAKYGLKSGQELLIPIKGVKVAIQETESPYFVHTVSAGETLYAISRMYHISTDSI
VALNPGSEKGIQIGTKLKIPQINSNTSSDSSISNNTRNQYIFHTIAPKETLFSVSRKYGI
SVESVLKQNPGLSPSNFSIGKVIRIIPEQNNERVQKNNGPKTFLYTVKKKETLYSIAQQF
DITIDDIRACNPGIGELKKNDTINIPVKESPTDISQALTHEDINQIYNDLYSIEKDGKIN
VAVLLPFMLSQKEDARSALYLEYYQGFLLAVDSLKKRGTSINVYAYDTEGKSSTLDNILS
KPEMKSIDLIIGPADNNLIQKTAEFALKNEINMVNAFSLKNDEANHNAHVLQTNIPHSYL
YAEAATELVRQFGNKQIIFLLDDNNADEKKDFINSVKAELRHKNIQFKDLHIASDPELTM
LNSSLPENSDILIISNSSTKNSVGKIIAPLTKLKDDRADLSITLFGYPEWQTYTKEYLNN
FHKLNTVIFTRFYTNPTDYDWKEFQKKFYFWYNKDMINANPKYGLLGFDTGMYFLSVLKQ
YGKNFENHLNQVESSSIQTDFKFQRINNWSGFINKSFYFVYFKPSYIIEKRVIR

Enzyme Prediction     

No EC number prediction in MGYG000001391_02949.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	6.25e-09	97	139	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	5.12e-08	98	140	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	5.44e-08	225	265	3	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	1.24e-07	161	205	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.55e-07	162	205	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62460.1	2.98e-240	11	654	10	654
BBD45766.1	1.45e-135	13	650	19	658
QUT48586.1	1.53e-133	96	654	40	600
QUT95613.1	4.01e-131	90	654	34	602
AST53296.1	4.01e-131	90	654	34	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	1.61e-07	39	251	30	253	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q2G0U9	2.71e-06	98	251	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sle1 PE=1 SV=1
Q6GC24	2.71e-06	98	251	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q7A1T4	2.71e-06	98	251	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1
Q5HIL2	2.71e-06	98	251	29	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999157	0.000162	0.000136	0.000129	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_02949.