CAZyme Information: MGYG000001391_03030

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_03030
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1118		123564.65	9.2104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 98200; End: 101556 Strand: +

Full Sequence      

MKQHSFLTALCLLFAAVPITGQTIKSSMEFAPSEHWVKPVEKPYREEICLNGTWAFAPVQ
LPVGFKEGETPAPALPGVNEVTFSKTPIRIPSPWNVNSFADKNGLGGDHRTYPSYPKEWE
SIKMGWLQKKFTVPASWKGKRIQIHFEAVAGKADIYVNGKVVGDNFDIFMPFDIDITDAV
KFGQENILNVGIQKSSLFDDRKSPLGRRTYQGGSFWGQHIAGIWQDVYLVALPQTRVADV
YIQPIVNKNTLEVEVTLRNDENKSVEVNISAAAYPWISKAGKTVLTAANPSSQLGSQAAL
QMPTQKVTIPAGKEIKTTLKTTVDNKLKLWSPSSPNLYGLVVKTSVNGKTNDSKYTRFGW
RQTELKDGKFWLNGKPFVLKGDSWHYMGIPQMTRRYPWAWYTALRDANCNAVRLHAQPFP
SFYLDVADEMGILVLDESAMWASDGGQKLGSEEFWKCSEEHMKQLVLRDRNHPSVFGWSV
SNEIMPIIRGVMRNAPGLEDNLVKYFKIWSDICFKYDPSRAWASADGEDDGRGLLPFYMV
HYGGEGAMKRAYESGKPWGVGEACNAYYGTPEQVSNAAKDGGRAYRSFEGRMESVAVDAY
NSLANQRKYNASYRSVFNLIWYGLQPLPLGLKDQTKAPTLKDGIAFTSFVEGKPGVQPER
IGPYSTTVNPGYDPSLPLYKTWPMFDAIKAANAEPMQPCKWVVKNVTPAKAANVKKVKSI
KILPESGKLSSELFRTGIPVKKMDTETVPELLIIDGANIPANATSVMQKVYAKGGTVVVW
GADPKKVNELNKILPSPVVITDRKATSLVFGTPDDITSGLTEADLYFSELHPAEFTTVGL
GGSLVKNSTTLLKACDTDWTKWNKQPEYAKTGMILRTEKESKPEGVVMLKKKMGQGNLVV
TTIPAAPRGAKAEKAVRALLTNMGIELGSGSDSGKPLLKSGEIVRVLMSGSYPVASVKEA
GKVNRVDLSKADGIKENTMLDGKAWKKYHSQSGLIDFKQAKLDGPTQNAETYMSFWVFSP
RPLDDLLIEPNMPVVDLEVAADDAVQVWLNGKMIISNLREGPIEGGKAVSKGLPLHQGWN
HFLIKAIQGGGGWFFNGRLICNQPDYLAEEMDSVLEKP

Enzyme Prediction     

No EC number prediction in MGYG000001391_03030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	577	6.3e-89	0.5186170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.77e-48	39	507	4	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.63e-40	38	520	3	443	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.07e-30	50	483	44	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	9.85e-20	129	483	126	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	1.22e-15	50	233	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXY77942.1	0.0	9	1118	10	1119
AYL93856.1	0.0	16	1118	15	1102
AEU36553.1	0.0	2	1118	25	1126
SDS47550.1	0.0	3	1109	15	1125
QQE13309.1	1.14e-315	20	1118	20	1114

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	4.65e-33	92	542	32	440	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6S6Z_A	2.26e-31	19	483	10	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.26e-31	19	483	11	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
5T98_A	2.46e-31	125	520	86	445	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	3.13e-31	76	507	32	431	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	9.74e-36	109	520	41	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q56307	1.24e-30	19	483	11	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.13e-29	88	483	93	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KPJ7	1.51e-28	88	520	82	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	7.12e-27	88	482	58	437	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999098	0.000174	0.000155	0.000142	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_03030.