CAZyme Information: MGYG000001391_03122

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_03122
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000001391_9|CGC1	46905.17	8.6191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 39923; End: 41140 Strand: +

Full Sequence      

MKQTLKDLTRKSVFLSMMLLACSGIFAKSKTKWAVNPELPMSVRMCQSEIIRNPEGWMLD
FSTKLKWNYCHGLECQAFLDVYDRYGGDYLYKYVKQFADTMINENGRIYGYKKTNYNLDH
VNSGKILFRLYEREKDPRYKIAMDTLRAQLASQPRTSDGGFWHKKIYPYQMWLDGIYMGS
PFYAQYAATFNEPEDFADVVSQFLIIAKHTYDKKTGLYRHAWDEIKALPWSDLKTGQAPH
VWGRALGWYMMAIVDALDFIPENQPGRDKMILILNDLVKILPKYQDQRTGAWYQVVDMPE
REGNYLEMSCTPMYAYAIAKGVRKGYLPEKSLSIAQKAYQGILDNFIVVDDKGIVSLTRI
CGVAGLGGRKPYRDGSFDYYVNEIVRDNDPKGVAPFIMLCLEMER

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	405	4.7e-124	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.03e-125	42	405	2	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.70e-108	61	405	28	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48639.1	9.94e-165	24	405	21	396
QUT77882.1	3.04e-164	20	405	15	395
QUT45768.1	5.71e-164	24	405	21	396
QQT77714.1	2.48e-163	35	405	27	396
QUU07653.1	2.48e-163	35	405	27	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.30e-112	67	404	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.63e-87	66	404	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.17e-86	66	404	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	2.03e-18	154	345	147	332	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.55e-18	130	345	103	323	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.18e-86	66	404	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.96e-39	178	402	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.96e-39	178	402	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.012085	0.333635	0.650144	0.002414	0.001047	0.000664

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_03122.