CAZyme Information: MGYG000001392_01054

Basic Information

• Species: Campylobacter_A concisus_R
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_R
• CAZyme ID: MGYG000001392_01054
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38537.3	9.111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001392	1890016	Isolate	not provided	not provided

• Gene Location: Start: 194093; End: 195127 Strand: -

Full Sequence      

MKILVSALEPSANLHLKEIFKNFEGEFELMGIFSEELGMPYMKSSEFSAMGFVEVLPLIF
KAKKAMKVMSQMAKEADAVLLIDSPAFNLPLAKAIKEAGAKAAVTYYILPQVWAWKPKRV
SVVERYCDNLASILPFDSKFYSRSTYVGHPLMDEIKLKKASLSSSGKVAFLPGSRRSEIS
RLMPVYRELAKKIEAKRLLVVPPFLLDKMGEIYGDVSDFDIVSNTPEALYESDFAFVCSG
TATLEAALIGTPFVLAYKAKAIDVFIARKFVKIKHAGLANIMFDFMGKEPLHEEFIQEFA
TAENLLRAYKSCDRQKFLKGCDELRAYLGHGSSKNVVKILKNME

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	313	1.6e-89	0.9350282485875706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	343	2	347	lipid-A-disaccharide synthase.
COG0763	LpxB	2.92e-101	1	333	2	367	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.15e-83	3	332	1	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK00025	lpxB	2.54e-78	1	339	2	370	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	8.34e-73	3	334	8	377	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX44490.1	2.08e-240	1	344	1	344
QPI05286.1	2.95e-240	1	344	1	344
QPH93352.1	5.96e-240	1	344	1	344
QPH98091.1	9.87e-239	1	344	1	344
QPH92270.1	1.15e-237	1	344	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.36e-23	77	308	92	340	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.36e-23	77	308	92	340	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	2.60e-132	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	2.60e-132	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	5.23e-132	4	343	5	364	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
Q17WJ2	5.97e-97	3	336	4	349	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1
B5Z7M7	1.55e-94	3	336	4	349	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001392_01054.