CAZyme Information: MGYG000001393_00467

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_00467
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000001393_9|CGC1	33913.7	6.4998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 102056; End: 102922 Strand: +

Full Sequence      

MLAYFLLVHRYPNQFKRLFKAIYHADNQYVVHIDKSSSEETHQDIHQFLSEYPNASLIES
MDANWGGYSLVDAELRGMKMLLEKSDSWEFFINLSGQDFPLQSQENICQFLIKNKGRNFI
KMSNQKDIRPETMHRIEKYVEESGRNITEVPSKNRPFMKDVTPYIGNQWMILCREFCEFV
THSDEIKKFRDFYRHSLIADEGFFQTVLMNTSYPPSVINDDKRAIDWIPMGDIKLRPRDF
TALDEKHLCSSKNLFARKFDETIDSDILTILEKHITTPQSFIPAKSII

Enzyme Prediction     

No EC number prediction in MGYG000001393_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	2	228	8.1e-69	0.932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	2.83e-44	2	227	1	226	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	1.83e-23	17	268	96	365	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE44859.1	2.99e-214	1	288	1	288
AJQ99210.1	3.49e-213	1	288	1	288
QLH67134.1	1.18e-132	1	278	1	278
ATM00873.1	5.39e-130	1	278	1	278
VEG97549.1	2.19e-129	1	278	1	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	2.12e-35	2	275	120	408	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	2.14e-35	2	275	124	412	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]
3OTK_A	7.31e-18	2	275	86	381	Structureand mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]
2GAK_A	3.40e-17	2	275	86	381	X-raycrystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAK_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAM_A X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_C X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_D X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5QQ50	3.33e-38	2	275	234	522	Xylosyltransferase 2 OS=Canis lupus familiaris OX=9615 GN=XYLT2 PE=2 SV=1
Q9EPI0	8.38e-38	2	275	234	522	Xylosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Xylt2 PE=2 SV=1
Q9EPL0	1.14e-37	2	275	234	522	Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
Q5QQ51	1.55e-37	2	275	234	522	Xylosyltransferase 2 OS=Pan troglodytes OX=9598 GN=XYLT2 PE=2 SV=1
Q9H1B5	1.55e-37	2	275	234	522	Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_00467.