CAZyme Information: MGYG000001393_00516

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_00516
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	MGYG000001393_9|CGC3	23598.19	10.3956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 152527; End: 153177 Strand: -

Full Sequence      

MKIRISCMLAVLLLAGCAKEQTPPQTVKLNVNNNARGSFLDARTPPEGEFGTYIRTASNS
YGIDETLIKAIIQVESGGNPHAVSTSNAIGLMQLKASTAGKDAYRKKGRGGQPTSRELKD
PAVNIDLGTAYLNILQNQQLAGITNPKTMRYAMIVSYANGAGAMLRTFSPNRKVAIDKIN
SMTPEQFYQHIQKRHPAAQAPRYLWKVNTAYLAMVQ

Enzyme Prediction     

No EC number prediction in MGYG000001393_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	214	1.7e-17	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	3.95e-91	53	211	2	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.28e-79	1	214	1	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	2.75e-72	53	210	195	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	3.95e-32	18	210	107	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.33e-28	54	179	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE44814.1	1.06e-153	1	216	1	216
AMH19265.1	1.06e-153	1	216	1	216
AMO82578.1	1.19e-150	1	216	1	216
QBJ33230.1	4.86e-150	1	216	1	216
QIP55919.1	4.86e-150	1	216	1	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	7.57e-64	57	216	29	188	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	2.16e-63	57	216	29	188	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	2.16e-63	57	216	29	188	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	2.16e-63	57	216	29	188	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
3T36_A	2.87e-63	57	214	46	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XGT6	4.17e-65	11	214	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhi OX=90370 GN=emtA PE=3 SV=1
B5R2X1	4.17e-65	11	214	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5R901	4.17e-65	11	214	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
C0Q334	4.17e-65	11	214	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1
Q7CQE4	4.17e-65	11	214	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_00516.