CAZyme Information: MGYG000001393_00951

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_00951
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		51707.15	10.5817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 48999; End: 50402 Strand: +

Full Sequence      

MKAKAIIFASMLLVGCQGVNHHAKEPEQHAQSLSSVSRSEAGQPSKDARATSARWLNDST
SNIAQEDLWGFISDDLKMKVPDNSRIREQKNKFLKNKSYLHDVTLRAEPYMYWIVEQIKQ
RKMPMELVLLPIVESAFNPHATSSANAAGLWQIVPQTGRNYGLKQNQWYDGRRDVAASTT
AALDMMQRMNRMFGGDWLLTVAAFNSGEGRVMQAVKANKRKGLPTDFWSLSLPRETSIYV
PKMLALSDLIKNNKRYGIKLPKSNDQRALAKVDVGQQIQLTQAAEMAGMSLTKMKAFNPG
YKKNVTAPNGPHYIMVPKAHVEQFKDSLAEGEIAAIQPNAQLASTNTSSKAQASSYKVRS
GDTISTIAKRLNISQKQLLSMNNLRSNSKLKAGQTLQVANSTSTSIADNSSITYKVRKGD
SLASIAKRHGVNIKDVMRWNSVITKASQIQPGDMLTLYVRDSANSNT

Enzyme Prediction     

No EC number prediction in MGYG000001393_00951.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	110	254	2.2e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	0.0	1	467	1	456	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	1.34e-59	118	248	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.07e-30	113	222	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.20e-17	133	245	10	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.44e-17	43	307	23	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE42033.1	0.0	1	467	1	467
AMH16673.1	0.0	1	467	1	467
AMO83349.1	0.0	1	467	1	467
QIP54836.1	0.0	1	467	1	467
AWV43822.1	0.0	1	467	1	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E0G_A	7.07e-17	411	460	2	48	LYSMDomain from E.coli MLTD [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.17e-189	1	462	1	447	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.17e-189	1	462	1	447	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	6.37e-33	99	227	10	142	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
Q49UX4	6.78e-08	333	466	6	138	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q37896	8.08e-07	358	457	167	262	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_00951.