CAZyme Information: MGYG000001393_01356

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_01356
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		27504.89	10.6584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 42324; End: 43061 Strand: +

Full Sequence      

MSKRRGQKHGLLGRVRIWSQRVILGIIGVWLAGIVIFAFLPVPFSAVMVERQFGAWLTGD
FGYVAHQDWVPMDEISPYMALAVIAAEDQKFPQHWGFDLGAIESVIDGSEKGDKPVRGAS
TISQQTSKNLFLWDGRSWIRKGLEAGLTLGTEVVWTKRRILTVYLNIVEFGPGVFGVEEA
ARRYFHKPASRLTASEAALLAAVLPNPHRFSAKAPSGYVLRRQQWILRQMRQLGGESYLK
QNKLN

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	63	231	1.6e-53	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.11e-143	8	243	1	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.83e-91	15	236	4	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.19e-81	3	237	8	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.73e-70	63	231	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.77e-35	70	241	70	238	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE43428.1	3.42e-178	1	245	1	245
AJR00714.1	2.31e-176	1	245	1	245
AMH17923.1	3.83e-175	1	245	1	245
ANC40708.1	1.80e-164	1	244	1	244
AMO80748.1	3.63e-164	1	244	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.96e-25	69	234	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.53e-24	69	234	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.49e-19	70	234	47	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	4.11e-18	70	234	42	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
7U4H_A	1.98e-17	70	211	43	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JR77	1.63e-128	18	245	14	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mtgA PE=3 SV=1
B1JL77	4.66e-128	1	245	2	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mtgA PE=3 SV=1
Q3V7N9	6.61e-128	1	245	2	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mtgA PE=3 SV=1
B2K3Y6	6.61e-128	1	245	2	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mtgA PE=3 SV=1
Q8ZB72	1.89e-127	18	245	14	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pestis OX=632 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43