CAZyme Information: MGYG000001393_01372

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_01372
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000001393_24|CGC1	72829.48	9.2564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 60970; End: 62898 Strand: +

Full Sequence      

MVMADNWRAWGIGLCLVAVSGSSFADSLDAQRQRYLQVKQAWDSNQMMTVNQLMPTLRDY
PLYPYLEYRQLTQDLGQATTIEIKDFIARNPTLPPAKSLPARYVNELSRRQDWTGLLVFS
PQPPKPIAARCNYYYAQYATGHQKTAWDGARDIWLSGQSLPTNCDKLFDAWKASGDQTPL
TVLERMRLALKKGNNGLVSFLAKQLPADYQTMGDALASLQADPRNVEAFARNVGPTDFTR
DATEIAFSSLARQDADAARAMLPTLVRLQKIDAKQRQAMEDSIAWRLMGNDATTEDIQWR
DNVIKNSNSASLIERRVRLALGNGNKKEIRTWLALLPQDVRDKDEWRYWNATVMIEDGKR
SEGESILRALTQQRGFYPMVAAQKLGITYPLQVEVANKPTAALTKDPAIDRIRELMYWNM
DNTARSEWGSLVSSKSKQDQAALARYAYEQNWADLSVQATITAKLWDHLEERFPMAWSQQ
FRQATEDKGISQSYAMAIARQESAWNPKAQSPVGASGLMQVMPKTAEHTAQMFNLSNYMN
SSQLLDPVTNIQIGTSYLEYVYQSLGRNRILSSAAYNAGPSRVNTWLGNTGGRVDAVAFI
ESIPFSETRGYVKNVLAYDAYYRYFMKRPTKILTDAEWERRY

Enzyme Prediction     

No EC number prediction in MGYG000001393_01372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	492	619	4e-28	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	642	3	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.75e-64	472	624	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	7.63e-48	344	635	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	7.97e-40	474	618	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.02e-35	481	593	1	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE43443.1	0.0	1	642	1	642
AJR00698.1	0.0	1	642	1	642
AMH17938.1	0.0	1	642	1	642
QBJ35380.1	0.0	1	642	1	642
AIU74228.1	0.0	1	642	1	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	6.83e-287	26	642	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.26e-285	26	642	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	2.82e-87	25	642	24	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	1.92e-86	31	642	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	5.67e-86	31	642	1	609	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.78e-293	7	642	9	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	2.93e-292	6	642	8	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.93e-292	6	642	8	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P44888	5.87e-73	277	642	227	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39433	1.48e-14	601	642	1	42	Soluble lytic murein transglycosylase (Fragment) OS=Enterobacter cloacae OX=550 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000470	0.998720	0.000248	0.000177	0.000181	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_01372.