CAZyme Information: MGYG000001393_01614

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_01614
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001393_30|CGC2	44056.33	5.6097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 63038; End: 64177 Strand: +

Full Sequence      

MLVYPVKHSPLLRQPERFIARSELKSLICKMTDNLINISDETGEFLLRLDDGRVIDTKGW
AGWEWTHGIGLYGIYQYYQQTGDQQMRAIIDDWFSARFAEGTPTKNVNTVCPFLTLAYRY
EETRDPRWLPYLERWAEWVMYEMPRTERGGMQHVTLAEENHQQLWDDTLMMSVLPLAKIG
KLLNKPEYIEEAKYQFLVHTQHLMERETGLWFHGWTFEGHHNFAKARWARGNSWLTMVIP
EFIDLLDLPEYDATRRFLIQVLESQVVALAKCQDQSGLWHTLLDDPNSYVESSATAGFAY
GILKAVRKRYIGAEYAAVAEEAVKGVIKHINAEGELTNVSFGTAMGRDYDYYRQIPLTSM
PYGQAMAILCLSEYMRVYL

Enzyme Prediction     

No EC number prediction in MGYG000001393_01614.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	3.4e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.64e-124	30	379	3	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.27e-116	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE44033.1	9.55e-291	1	379	1	379
AJR00207.1	3.89e-290	1	379	1	379
AMH18367.1	5.30e-288	1	379	1	379
ANC39099.1	7.76e-281	1	379	1	379
AIU73815.1	7.76e-281	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.71e-224	3	378	5	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.55e-217	3	378	6	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.50e-145	22	379	6	373	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	1.73e-18	164	355	199	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.40e-51	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	1.12e-09	165	373	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	6.81e-09	180	322	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.81e-09	180	322	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_01614.