CAZyme Information: MGYG000001393_01907

Basic Information

• Species: Hafnia paralvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia paralvei
• CAZyme ID: MGYG000001393_01907
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000001393_38|CGC1	37576.27	6.8926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001393	4880992	Isolate	not provided	not provided

• Gene Location: Start: 26811; End: 27779 Strand: +

Full Sequence      

MGHCNYKYDEIMLIKNKLSESKTLNITFCFDNNFAMPCGVAITSVIKNNPNINLHFHLFS
EDVSDDSLTRFSKIKGDNVSLTVYKIHGDMYINEKTLTQGLSKATCLRFLAPEIIDSSIE
RILYLDGDMICLGMLDGLLDLNLENRIAAVVEDLAVTQKKYELQTHLPPIDNYFNAGFMF
INTVEWKKNNITEHCFEMINNGTIYKFADQDVLNILLNDKKLVLAREYNRIITLTPLKLL
DSEFEFNSIIIHYTTENKPWYTIFESRIFSRYFNASPWSDFRLDEAPTATAFRLKAKKYL
KENNYISYIKYYLRYLIKKHQS

Enzyme Prediction     

No EC number prediction in MGYG000001393_01907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	14	262	3e-53	0.914396887159533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	2.47e-61	24	262	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
PRK15171	PRK15171	6.27e-51	7	319	2	332	lipopolysaccharide 3-alpha-galactosyltransferase.
pfam01501	Glyco_transf_8	1.50e-44	25	260	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	3.57e-44	23	319	2	316	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	1.24e-09	40	260	18	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQE41759.1	2.28e-236	1	322	14	335
AMH18699.2	8.70e-231	1	322	1	322
AWV43944.1	5.54e-218	1	322	1	322
AJQ99808.1	2.96e-101	5	316	8	322
QQE44450.1	2.05e-100	5	316	14	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SS9_A	1.09e-11	24	214	1	193	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.98e-11	25	214	2	193	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
6U4B_A	7.08e-11	26	262	304	570	ChainA, WbbM protein [Klebsiella pneumoniae]
5GVW_A	5.60e-09	26	260	8	235	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	5.65e-08	26	260	8	235	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27129	4.76e-41	18	320	22	335	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19817	7.45e-38	19	305	21	318	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P19816	4.24e-36	19	319	23	334	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	3.46e-33	19	319	24	336	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
A0A0H2URH2	4.59e-18	25	268	4	237	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001393_01907.